KEGG   Pyrobaculum calidifontis: Pcal_1626Help
Entry
Pcal_1626         CDS       T00483                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Pcal_1626
Enzymes [BR:pcl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Pcal_1626
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1514831..1515628)
Genome map
AA seq 265 aa AA seqDB search
MLKSVCREGDVKLFGAPMEDTVSFRPGTRFAPQKIRSILPYLEYTTVLGNVAKPLCDLGD
VELLHGAPGENVSRIEAFIRKTTPPFIMLGGEHTATLAALRALRPDVYVHIDAHFDLRDE
WPPGQKLSHATFARRAHEELGFYALYIGVRAYDDEEYKYAKEAGFYVVEGSDFTRSEVAD
AVATASGRVYLSLDIDVLDPSEAPGVGTPEAGGLSFRKLELLLADLMLSLKPVAVDVMEY
SPPFDVSDITAAKVVRILMHISSLL
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagagcgtctgccgcgagggagacgtaaagctgttcggcgcgccgatggaggac
accgtcagctttaggccgggcactcgctttgctccacagaaaatacggagcattctgccg
tatctagagtacacgactgtcctcggcaacgtggcaaagccgctctgcgacctcggcgac
gtggagctactgcacggggcgcccggcgaaaacgtgtcgcggatagaggccttcattagg
aagactacgccgccctttataatgctgggtggcgaacacacggctacgcttgccgcactg
agggcgctgaggcccgacgtgtatgtccacatagatgcccacttcgacctccgcgacgag
tggccgcctgggcaaaagctatcccacgccacttttgcaagaagggcgcacgaggagttg
ggcttctacgccttgtacataggggtcagggcatacgacgacgaggagtacaaatacgca
aaagaggcaggcttctacgtggtagaggggtcagacttcacgaggtccgaggtggcagac
gccgtggcaactgcctcggggagagtgtacttaagcctagacatagacgtcttagacccc
tccgaggcgccaggcgtggggacgccggaggccggcggcctctcctttagaaaactggag
ctcctactggccgacttaatgctctctttaaagcccgtggccgtagatgtcatggagtac
agccccccgttcgacgtctccgacataactgcggcgaaggtggtgaggatactaatgcac
atttcttctctgctttag

DBGET integrated database retrieval system