KEGG   Pyrobaculum calidifontis: Pcal_1657Help
Entry
Pcal_1657         CDS       T00483                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pcal_1657
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pcal_1657
   00640 Propanoate metabolism
    Pcal_1657
   00660 C5-Branched dibasic acid metabolism
    Pcal_1657
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pcal_1657
Enzymes [BR:pcl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pcal_1657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1546723..1547871
Genome map
AA seq 382 aa AA seqDB search
MKLHEYEAKELFAKYGVKIPPGRLALTPEEVRKAAEEMGPPVVLKAQVVVAGRGKAGGIK
VAKRVEEAYELSKQMFGMNIKGLTVRKLYVTKYLEVEREMYLSLIIDRATRRFLFLASPV
GGMDIEEIAKTTPEKIKRVYVDPFVGLRDYHVRSIVSWLGFSPGTAQWQQAASIVQAMYK
IAVDYDAELVESNPLALTKEGDVVPLDARVIVDDNALFRHPELEKALEEDPRDITEFEAY
AKKIGFHYVELDGDIGIIGNGAGLTMATMDLVYHFGGRPANFLDIGGGASREVVREAVKV
LLNHPRAKVIFINIFGGITRADEVAYGVKEALQAAGGTTKKIVVRMKGTNEELGRAILAE
IGVPLFESAEEAAKKAVELAKL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcacgaatatgaggcaaaggagcttttcgcaaagtacggggtaaagatcccg
ccgggcaggctggcgctcacgcctgaggaagtgcgcaaagcggcggaggagatggggccg
ccggttgtgctaaaggcgcaggtggtggtggctgggcgcggcaaggccggcggcataaaa
gtggccaaacgcgtggaagaggcgtatgagctgtcgaagcagatgtttgggatgaatata
aagggcctaacggtgaggaagctgtatgtgactaagtacttggaggtggagagggagatg
tacctctccctcatcatagatagggccactcggcggtttctcttcctcgcctcgcccgtg
ggaggcatggacatcgaggaaatcgccaagactaccccggagaagattaagagagtgtac
gtggaccccttcgtggggcttagagactaccacgtccgctctatagtctcgtggctcggc
tttagcccaggtacggctcagtggcaacaagcggcctccattgttcaagccatgtacaag
atagcggtggactacgacgcagagctagtggagtccaaccctctcgccctcaccaaggag
ggcgacgtcgtgcctctcgacgcgagggtgatcgtagatgacaacgccttgtttagacac
ccagagctggagaaggccctcgaggaggacccccgcgacatcacggagtttgaggcctac
gctaagaagataggcttccactacgtggagctcgacggcgacattggcataataggcaac
ggcgccggcctcactatggcgaccatggacttagtctaccacttcgggggcaggccggcg
aatttcctcgacatcggcggcggcgccagcagagaggttgtgagggaggctgtgaaagtc
ctcctcaaccaccccagggccaaggtgatcttcataaacatctttggcggcattactagg
gctgacgaagtcgcctacggcgttaaagaggccctccaagccgctgggggtaccacaaag
aagatcgtggtaagaatgaaggggacaaacgaggagcttggaagagccattttagccgaa
ataggagtaccactctttgaaagcgccgaagaggcagctaaaaaggcggtagaactggcc
aaactatga

DBGET integrated database retrieval system