KEGG   Pyrobaculum calidifontis: Pcal_1657Help
Entry
Pcal_1657         CDS       T00483                                 

Definition
succinyl-CoA synthetase (ADP-forming) beta subunit (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pcal_1657
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pcal_1657
   00640 Propanoate metabolism
    Pcal_1657
   00660 C5-Branched dibasic acid metabolism
    Pcal_1657
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pcal_1657
Enzymes [BR:pcl01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pcal_1657
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1546723..1547871
Genome map
AA seq 382 aa AA seqDB search
MKLHEYEAKELFAKYGVKIPPGRLALTPEEVRKAAEEMGPPVVLKAQVVVAGRGKAGGIK
VAKRVEEAYELSKQMFGMNIKGLTVRKLYVTKYLEVEREMYLSLIIDRATRRFLFLASPV
GGMDIEEIAKTTPEKIKRVYVDPFVGLRDYHVRSIVSWLGFSPGTAQWQQAASIVQAMYK
IAVDYDAELVESNPLALTKEGDVVPLDARVIVDDNALFRHPELEKALEEDPRDITEFEAY
AKKIGFHYVELDGDIGIIGNGAGLTMATMDLVYHFGGRPANFLDIGGGASREVVREAVKV
LLNHPRAKVIFINIFGGITRADEVAYGVKEALQAAGGTTKKIVVRMKGTNEELGRAILAE
IGVPLFESAEEAAKKAVELAKL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaagttgcacgaatatgaggcaaaggagcttttcgcaaagtacggggtaaagatcccg
ccgggcaggctggcgctcacgcctgaggaagtgcgcaaagcggcggaggagatggggccg
ccggttgtgctaaaggcgcaggtggtggtggctgggcgcggcaaggccggcggcataaaa
gtggccaaacgcgtggaagaggcgtatgagctgtcgaagcagatgtttgggatgaatata
aagggcctaacggtgaggaagctgtatgtgactaagtacttggaggtggagagggagatg
tacctctccctcatcatagatagggccactcggcggtttctcttcctcgcctcgcccgtg
ggaggcatggacatcgaggaaatcgccaagactaccccggagaagattaagagagtgtac
gtggaccccttcgtggggcttagagactaccacgtccgctctatagtctcgtggctcggc
tttagcccaggtacggctcagtggcaacaagcggcctccattgttcaagccatgtacaag
atagcggtggactacgacgcagagctagtggagtccaaccctctcgccctcaccaaggag
ggcgacgtcgtgcctctcgacgcgagggtgatcgtagatgacaacgccttgtttagacac
ccagagctggagaaggccctcgaggaggacccccgcgacatcacggagtttgaggcctac
gctaagaagataggcttccactacgtggagctcgacggcgacattggcataataggcaac
ggcgccggcctcactatggcgaccatggacttagtctaccacttcgggggcaggccggcg
aatttcctcgacatcggcggcggcgccagcagagaggttgtgagggaggctgtgaaagtc
ctcctcaaccaccccagggccaaggtgatcttcataaacatctttggcggcattactagg
gctgacgaagtcgcctacggcgttaaagaggccctccaagccgctgggggtaccacaaag
aagatcgtggtaagaatgaaggggacaaacgaggagcttggaagagccattttagccgaa
ataggagtaccactctttgaaagcgccgaagaggcagctaaaaaggcggtagaactggcc
aaactatga

DBGET integrated database retrieval system