KEGG   Pyrobaculum calidifontis: Pcal_1674Help
Entry
Pcal_1674         CDS       T00483                                 

Definition
acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:pcl01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:pcl00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1562554..1563741
Genome map
AA seq 395 aa AA seqDB search
MDEAISLLSKLISIPTVNPPGEKYQEFVEFAERFFKSLGMETEVLEVPKSEVAARCPECA
DYPRLILLARIGEPKIHFNGHYDVVPPGPLESWKVTRPFEPVYRDGRLYGRGAVDMKGGL
AAIMLAAERAVKAGLKNFEVSFVPDEEIGGETGAGYLARSGKVKAPWVIIAEGSGEDNVW
IGHRGLVWFLVEVYGKQAHGSTPWLGLNAFEGAAYIAYRLREYAKEVSARVSKYEYDDPR
AASPTVTIGGEVRGSVKTNVVPGYFAFSVDRRVIPEEDLEQVKREFIEFVERVAKELPHR
VEVKVTNVSEAALIEPTHPLVEALSSSVEEVIGRKPRRTVCVGGLDARFFIKAGIPTVTY
GPGPIGLAHAPDEYVEVRQVVNVAQVYFNLLKKLR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggatgaggctatctctctcctaagcaagctgatttccatacctacggttaatccgccg
ggggagaagtaccaggagttcgtagaattcgctgagaggttcttcaaatccctcggcatg
gagaccgaggtcttagaggtgcctaagtccgaggtggcggcgcggtgccccgagtgcgca
gactaccccaggctcatcctactcgcccgcataggtgagccaaagatacacttcaacggc
cactacgacgtagtgccccccggccccttggagagctggaaggtgacaaggccatttgag
cccgtctatagagacggcagactctacggaagaggcgccgtggacatgaagggcggcctc
gcggccattatgctcgcggccgagcgggccgtaaaggcggggttaaagaactttgaagtc
tcctttgtacccgacgaggaaattggcggagagacgggggccggctacctcgcgagatct
ggaaaggtaaaggctccgtgggtgataatcgccgaggggtcgggcgaggacaacgtctgg
attgggcatagggggcttgtgtggttcctcgttgaggtctacggcaaacaagcccacgga
tctactccgtggctgggcttaaacgcctttgaaggcgccgcctacatcgcctacaggctg
agggaatatgcaaaggaggtctccgcccgtgtgagcaagtacgaatacgacgatcccagg
gcggcgtcgcccactgtgaccatcggcggcgaggtgcggggctctgtgaagaccaacgtg
gtgccggggtacttcgccttctcagtagacaggagagtgatccccgaggaggacttggaa
caagtgaagcgcgagttcatcgaatttgtagagagagtggcaaaggagcttccacaccga
gttgaggttaaggtaaccaatgtgtcagaggcggcgctcatcgaacccactcacccgctg
gtggaggccctctccagctccgtggaggaggtgatagggaggaagccaaggcgcactgtg
tgcgtcggcggcttagacgccaggttcttcattaaggccggcatacccactgtgacatat
ggcccaggtccaataggcctagcccacgcccccgacgaatatgtagaggtgaggcaggta
gtcaacgtggcccaagtgtacttcaaccttttgaaaaaactgaggtag

DBGET integrated database retrieval system