KEGG   Pyrobaculum calidifontis: Pcal_1674Help
Entry
Pcal_1674         CDS       T00483                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pcl  Pyrobaculum calidifontis
Pathway
pcl00300  Lysine biosynthesis
pcl01100  Metabolic pathways
pcl01120  Microbial metabolism in diverse environments
pcl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Pcal_1674
Enzymes [BR:pcl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Pcal_1674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ABO09091
JGI: pcal1674
UniProt: A3MWS4
Position
1562554..1563741
Genome map
AA seq 395 aa AA seqDB search
MDEAISLLSKLISIPTVNPPGEKYQEFVEFAERFFKSLGMETEVLEVPKSEVAARCPECA
DYPRLILLARIGEPKIHFNGHYDVVPPGPLESWKVTRPFEPVYRDGRLYGRGAVDMKGGL
AAIMLAAERAVKAGLKNFEVSFVPDEEIGGETGAGYLARSGKVKAPWVIIAEGSGEDNVW
IGHRGLVWFLVEVYGKQAHGSTPWLGLNAFEGAAYIAYRLREYAKEVSARVSKYEYDDPR
AASPTVTIGGEVRGSVKTNVVPGYFAFSVDRRVIPEEDLEQVKREFIEFVERVAKELPHR
VEVKVTNVSEAALIEPTHPLVEALSSSVEEVIGRKPRRTVCVGGLDARFFIKAGIPTVTY
GPGPIGLAHAPDEYVEVRQVVNVAQVYFNLLKKLR
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggatgaggctatctctctcctaagcaagctgatttccatacctacggttaatccgccg
ggggagaagtaccaggagttcgtagaattcgctgagaggttcttcaaatccctcggcatg
gagaccgaggtcttagaggtgcctaagtccgaggtggcggcgcggtgccccgagtgcgca
gactaccccaggctcatcctactcgcccgcataggtgagccaaagatacacttcaacggc
cactacgacgtagtgccccccggccccttggagagctggaaggtgacaaggccatttgag
cccgtctatagagacggcagactctacggaagaggcgccgtggacatgaagggcggcctc
gcggccattatgctcgcggccgagcgggccgtaaaggcggggttaaagaactttgaagtc
tcctttgtacccgacgaggaaattggcggagagacgggggccggctacctcgcgagatct
ggaaaggtaaaggctccgtgggtgataatcgccgaggggtcgggcgaggacaacgtctgg
attgggcatagggggcttgtgtggttcctcgttgaggtctacggcaaacaagcccacgga
tctactccgtggctgggcttaaacgcctttgaaggcgccgcctacatcgcctacaggctg
agggaatatgcaaaggaggtctccgcccgtgtgagcaagtacgaatacgacgatcccagg
gcggcgtcgcccactgtgaccatcggcggcgaggtgcggggctctgtgaagaccaacgtg
gtgccggggtacttcgccttctcagtagacaggagagtgatccccgaggaggacttggaa
caagtgaagcgcgagttcatcgaatttgtagagagagtggcaaaggagcttccacaccga
gttgaggttaaggtaaccaatgtgtcagaggcggcgctcatcgaacccactcacccgctg
gtggaggccctctccagctccgtggaggaggtgatagggaggaagccaaggcgcactgtg
tgcgtcggcggcttagacgccaggttcttcattaaggccggcatacccactgtgacatat
ggcccaggtccaataggcctagcccacgcccccgacgaatatgtagaggtgaggcaggta
gtcaacgtggcccaagtgtacttcaaccttttgaaaaaactgaggtag

DBGET integrated database retrieval system