KEGG   Pyrobaculum calidifontis: Pcal_1709Help
Entry
Pcal_1709         CDS       T00483                                 

Definition
(GenBank) porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
pcl  Pyrobaculum calidifontis
Pathway
pcl00860  Porphyrin and chlorophyll metabolism
pcl01100  Metabolic pathways
pcl01110  Biosynthesis of secondary metabolites
pcl01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Pcal_1709
Enzymes [BR:pcl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Pcal_1709
Exosome [BR:pcl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Pcal_1709
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ABO09126
JGI: pcal1709
UniProt: A3MWV9
Structure
PDB: 

Jmol
Position
complement(1591629..1592645)
Genome map
AA seq 338 aa AA seqDB search
MRVQFPTTRPRRLRASKIIRDAVAETQIDAGDFIYPLFVKPGGEREPIGPMPGIYRWPVG
RELINHVEEALSLGINKFILFGVLPDELKNPEGTGGYDPEGVVPRAIRLIKEIFGDRVLV
FADVCLCEYTDHGHCGVVKEKRDRWYVDNDETIKLYAKEAVVYAEAGADFVAPSGMMDGQ
VREIRRALDAHGFEEVGIMAYSAKYASAFYGPFRVAAASAPKFGDRRTYQMDPRNAYEAL
KEVAMDLEEGADIVMVKPALAYLDVIRLVKQHFPWVPLAAYNVSGEYSLVKAAATAGYVD
ERTITLEILTAIKRAGADLILTYHALEAAKWIKEGLPF
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgtacagtttccaacgactaggcctaggcgcctacgtgcctcaaagataatccgc
gacgccgtcgctgagacgcagatcgacgctggcgacttcatatatccactgtttgtaaaa
ccgggcggcgagagggagcccataggccccatgcccgggatatacaggtggcccgtcggc
cgcgagttgataaaccacgtggaagaggccctgtcgttgggcataaataagttcattctc
ttcggcgtattgcctgacgagcttaagaaccctgaaggcaccggcggctacgaccccgag
ggcgtagtgccaagggccatacggctcataaaggagatcttcggcgatagggtcctagtt
tttgcagacgtgtgcctctgcgaatacacagaccacggccactgcggcgtggtgaaggag
aagagggacaggtggtacgtcgacaacgacgagacgataaagctttatgcgaaagaggcc
gtcgtatatgcggaggctggggcagacttcgtggcgccaagcggcatgatggacggccaa
gtgagagaaattaggcgggcgctagacgcccacggctttgaggaggtcggaataatggcc
tacagcgccaaatacgcctcagcgttttatggcccattccgagtggccgcggcatcggcc
ccaaagttcggcgataggaggacttaccaaatggacccccgcaacgcctacgaggcgttg
aaggaggtggccatggaccttgaggagggggccgacatagtgatggtaaaaccagccttg
gcctacctagacgtcattaggcttgtgaaacagcactttccatgggtccccctagccgca
tataacgtctctggcgagtactccctcgtaaaggcggccgcgacagccggctatgtcgac
gaaaggacgataacgctagagatattgacggcgataaagagggcaggcgccgatctaata
ttaacatatcacgcgcttgaagcggccaagtggataaaagagggactgcccttctag

DBGET integrated database retrieval system