KEGG   Pyrobaculum calidifontis: Pcal_1769Help
Entry
Pcal_1769         CDS       T00483                                 

Definition
pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pcal_1769
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcal_1769
   00020 Citrate cycle (TCA cycle)
    Pcal_1769
   00620 Pyruvate metabolism
    Pcal_1769
   00640 Propanoate metabolism
    Pcal_1769
   00650 Butanoate metabolism
    Pcal_1769
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pcal_1769
   00680 Methane metabolism
    Pcal_1769
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pcal_1769
Enzymes [BR:pcl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pcal_1769
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1640830..1641981
Genome map
AA seq 383 aa AA seqDB search
MKTLTVQRTALTGNYAVAHAVKMAKPHVIAAYPITPQTTIVEKLAEFVEKGELNASFVNV
ESEFSAMSVVYGAAMAGARAFTATSSHGLLYMYEAIWWTALSRAPVVMAVVTRTIGPPWN
IHVEHNDILTLRDSGWIIAMAETVQEAFDLTLQAFKIAETVVLPMAVGVDGFILSHATEP
VEIPPQELVDKFLPPRRPDVPLALRPGNAITFGNLPSDNRIHARHKAAIYQAHQEAKAVI
TQVDREYGKMFGRGYQGLVEWYKASDAKYIAVCTGAWCSDAKDAVDALRERGVPIGLMRL
RFIRPFPREEVEKLDQYDLVVVYDRDITPAGGILGIEVKSALRRAKVVNIIAGIAGVDFD
NRNFYETLQRALEGKYRDVEVVI
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaagacgctgactgtacagaggaccgctctcactggaaactacgcggtggcgcacgcg
gttaagatggcaaaaccgcacgtaatagcggcttacccaattacgcctcagaccaccatc
gtggagaaattggccgagtttgtggaaaagggcgagttaaacgcgagctttgtgaatgtg
gaatcggagttctcagcgatgtctgtcgtatacggcgccgccatggcgggcgcccgggcc
ttcaccgccacgtcttcacacggccttctctacatgtacgaagccatctggtggactgcc
ctaagcagagcgcccgtcgtaatggcggttgtgactagaaccataggccctccttggaac
atacacgtagaacacaacgacatattgacattgagagacagcgggtggataatcgctatg
gcggagactgtacaagaggcctttgacttaactcttcaagccttcaaaatcgcggaaacc
gtggtcctcccaatggccgtgggagtagacgggtttatactctcgcatgcaacagagcct
gtggagattccaccgcaggagctcgtggacaaattcctgccgcctaggaggccagatgtg
ccgctggctttgcgcccgggtaatgcaataactttcggaaatcttccctctgacaatcgg
atacatgctaggcacaaggcggcgatatatcaggcacatcaagaggcaaaggcagtgata
acacaagtggacagggagtatggaaaaatgtttggacgcggctaccaaggccttgtggag
tggtacaaggcaagtgacgccaagtacattgccgtgtgtaccggcgcctggtgtagtgat
gcaaaagatgcggtagacgccttgagagagaggggcgtcccaattgggctaatgcgtctg
agattcataaggccgttcccacgcgaagaggtggagaagctagatcaatacgacttagtc
gttgtatacgatagagacataacgccggcgggggggatattggggattgaggtaaaatcg
gcgcttaggagggcaaaagtggttaacatcatagccggaatagcgggggtggactttgac
aaccgcaacttctacgaaactctccaaagggcgttggagggcaagtacagggacgtggag
gtggtaatatga

DBGET integrated database retrieval system