KEGG   Pyrobaculum calidifontis: Pcal_1928Help
Entry
Pcal_1928         CDS       T00483                                 

Definition
nitrous oxide reductase apoprotein (EC:1.7.2.4)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Energy metabolism
   00910 Nitrogen metabolism
    Pcal_1928
Enzymes [BR:pcl01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.2  With a cytochrome as acceptor
    1.7.2.4  nitrous-oxide reductase
     Pcal_1928
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1794959..1796980
Genome map
AA seq 673 aa AA seqDB search
MGLVGGLALSQLLAKGAVAPAPPGVSARVQELAAARGLSPQDVENAVATYLPGGKYDEFY
MFSSGGHSGQVAVYGLPSLKLYRIIAVFTPEPWQGWGYHDRKTMEVLFSERATAGRPLSW
GDTHHPEFDRQNAEYVGRWLFIGDKVNGRAAAISLLDFETKDIVKIPNVQTIHGGAFTTP
NTEYVLYATQYPAPWEPGRGYKPGVTKVPWSQVVKDEKYFWEYMRGALTFLAFDRNTGRF
DLSKSFQIEVPPYVQDLSTISWGPGDGLAFVNSFGTEGMFGETPYEAKLSKNDYDLLHIV
LWRKAEDLCLRQGRCKEINGIKVLSLEDAIKEGVLFFVREPKSPHGVDTSPGGHFISVGG
KLAPYATVYSTEKIKQAIADKKFEGQDRYGVPILDYGSVVAGQVEVCLGPLHTEFDGRGN
AYISCFVENVVTKFTLGSPEYRGDKPFTVVDKVQIHYNVGHICVPESNSPNPAGKYLVAL
NKWSIDRFFPVGPLKPQNFQLIDISGDKMRLLAEVPVGWGEPHYAKAIRAEKIKPLDVYP
VGTDPHVMKDGQFQLSSNAVTEIGKERVQRYQLPDGRWVTEVWGTVIRSTIRPNIIVAKK
GDIVRLHLTNIEKSVDATHGLAIAEYNVAASLEPGEYAEIEFVADIPGVFAFYCYEFCSP
LHLEMVGWLVVEE
NT seq 2022 nt NT seq  +upstreamnt  +downstreamnt
gtggggctggtggggggcctcgccttaagccagctcttggccaagggggctgtggcgccg
gcgccccccggcgtgtcggcacgggtccaagaattggccgcggcaagagggctgtcgcct
caagacgtagaaaatgccgtggccacgtatctccccggagggaagtacgacgagttctac
atgttctcaagcggcggccactcggggcaggtggcggtctacggccttccctctttgaag
ctctaccgcataatagccgtattcactcccgagccttggcagggctggggctaccacgat
aggaagaccatggaagttctcttcagcgagagagccaccgctggcaggccgctcagctgg
ggcgacacccaccaccccgagttcgataggcaaaacgccgaatatgtcggcagatggctg
ttcattggcgacaaagtgaacgggagagcagccgccatttccctactagactttgagacc
aaggacattgtaaaaatccccaatgtacaaactatccacggcggcgccttcactactcca
aacacggagtacgtcttatacgccacgcagtatccagcgccttgggagccgggcagagga
tataagccaggtgtcaccaaggtcccgtggagccaagtggtaaaagatgaaaagtacttc
tgggagtacatgaggggtgccctcacgttcctcgcctttgaccgtaacactgggagattc
gacttgtcgaaaagcttccaaatagaggtcccgccctatgtgcaagacctttccacaata
tcctggggccccggcgacggtttggcgtttgtcaactcctttggcacagagggcatgttc
ggagagacgccatatgaggcaaagttgtctaagaacgactacgacctgttacacatagtg
ctgtggagaaaggctgaggacctctgcttgaggcaaggccgttgcaaggagataaacggc
ataaaagtcctctccctagaggacgcgattaaggagggggtgttgttctttgttagagag
cccaagagtccccacggcgtagatacatcccccggcgggcactttatatctgtgggaggc
aaactggccccctacgccacagtctacagcacggagaagataaagcaggccattgcagat
aagaagttcgaggggcaggacagatacggagtgcctatattggactacggtagcgtggtt
gcgggacaggtggaggtctgcctaggcccactacacacagaattcgacgggagaggcaac
gcctacatcagttgcttcgtggaaaatgtagtaacaaaattcaccctaggctcgcccgag
tacagaggcgataagccgttcacagtggtagacaaagtgcagatacactacaacgtgggc
cacatatgtgtgccagagtctaattcgcctaatccagctgggaagtatctagtggcgttg
aacaagtggtcaatagacagattcttcccagtggggccgcttaagcctcagaacttccag
ctaatagatatatctggtgataagatgaggctactcgcagaggtgcccgtgggctggggc
gagccgcactacgccaaggctatacgggctgagaagataaagccgcttgacgtatatcca
gtgggcacggacccccacgtcatgaaagatggccagttccagttgagctccaatgcggtg
actgaaataggcaaggagcgggtgcagaggtatcagctaccagacgggaggtgggtcact
gaggtttggggcacggtgattaggtcgactataaggcctaacattattgtggcaaagaag
ggcgacatagtgcgcctccacttaaccaacatagagaagagcgtagatgccacacatggc
cttgccattgctgagtacaatgtggcggcctcgctggagcccggcgaatatgccgagata
gagtttgtggcagatatacccggcgtatttgccttctactgctacgagttctgctcaccg
ctccacttagaaatggtgggatggctggtagtagaggagtaa

DBGET integrated database retrieval system