KEGG   Pyrobaculum calidifontis: Pcal_1949Help
Entry
Pcal_1949         CDS       T00483                                 

Definition
Cytochrome-c oxidase (EC:1.9.3.1)
Orthology
K02274  
cytochrome c oxidase subunit I [EC:1.9.3.1]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Oxidative phosphorylation
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Energy metabolism
   00190 Oxidative phosphorylation
    Pcal_1949
Enzymes [BR:pcl01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     Pcal_1949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1813182..1814864)
Genome map
AA seq 560 aa AA seqDB search
MATTTKFVFEDRFAKVAITFSYIMLLLGGLFGFLQVLSRAPGMPQLETPELYYSGLTLHG
TALAILWTAFFIMGLAVFVVTRELDMRLNPVLLRSACVLAVLGTLMAAVEILRGEAAVLY
TFYPPLYASPLFFIGLAVLLIGTWLFGAAILHAIFKWKAANRDKEVPLGVYGVFTTVMIW
LYATPPLAYAVLFRSLPMALFGSNAPVDVLEWRLWFWYFGHPLVYFWLVPAVTVWYTILP
RVLGVEVFSKTMAKAAFFLYLIASTPVGLHHQFVDPGVHPVYKYLHTVLTYVVAVPSFLT
AFNIVATLERAGRARGGKGLFGWITALPWGKDPVFTGITFAIILFGIAGFSGVVNASFNV
NYMVHNTAWIVGHFHLTVGGGVTLTFISTSFLLVPLLFGRDYVAKRLLIAVPTLWFIGQL
IFGFAYHLAGIYGAPRRTYLPPYLQNPDLTQGAHFVPDWIPLLQLGAVGGVTFALGGALF
LLLTFATIFAGPRVRLSGGEVKISPDPDRATFFDKLGLVILIGLVLIVIAYSLPAIEVYS
RGLSPAPPYNPLTGAPVTTS
NT seq 1683 nt NT seq  +upstreamnt  +downstreamnt
atggctactacaacaaagtttgtattcgaggacagattcgccaaggtggcgataacgttt
agctacataatgcttctgctgggcggcctctttggatttctgcaagtgttgtccagggcc
cccggcatgccgcagttggagacgcccgagctctactacagcgggctgacgctacacggc
actgccttggcgatattgtggacggcgttcttcataatgggccttgccgtgttcgtggtg
acgcgggagctcgacatgaggctgaacccggtgctcctccgctctgcctgcgtcttggcc
gttctcggcactctaatggcggctgtggagattctcagaggagaggccgcagtgctctac
accttctacccgccgctgtacgcctcgcccctcttcttcataggcctagccgtcttgctt
ataggcacttggctgttcggcgccgccatcttgcacgccattttcaaatggaaggccgct
aatagagacaaggaggtgcctctgggcgtctacggcgtgttcaccaccgtgatgatatgg
ctctacgccactccgccgctggcatacgccgtgttgttcaggtctctccccatggccctc
ttcggctccaacgccccagtagacgtcttggagtggaggctgtggttctggtactttggc
cacccgctggtctacttctggctagtgcccgcggtgactgtatggtacaccatcttgccc
agagtgctcggcgtggaggtgttcagcaagaccatggccaaggccgccttcttcctctac
ctaatagcctccaccccggtgggcctgcaccaccagttcgtagacccgggcgtccacccg
gtgtacaagtatttgcacacggtgctcacgtacgtggtggctgtgcccagcttcctcacg
gcctttaacatagtagccactctggagagggcgggcagggccaggggtgggaagggcctc
ttcggctggataaccgcgttgccctggggcaaagaccctgtcttcaccggcataaccttt
gccataatcctctttggaattgctggcttctccggcgtggttaacgcctcctttaacgtg
aactatatggtgcacaacaccgcctggatagtgggccacttccacttgacggtgggcggc
ggcgtgacgctgacattcatctccacctccttcctgctggtgccgctcttgtttggcaga
gactacgtggccaagaggctcttgatcgcggtgcccacgctgtggttcataggccagctc
atcttcggcttcgcctaccacctggcgggaatatatggagcgccgcggaggacctatctg
ccgccctatctgcagaaccccgacttgacgcaaggcgcccatttcgtgcccgactggatt
ccgctcctccagctcggcgcagtgggcggcgtcaccttcgcgctgggaggcgccctgttc
ctactgctgacctttgccacaatatttgcaggccccagggtgagactgagcggcggcgag
gtgaagatatccccagaccccgaccgcgccacattcttcgacaagctgggcctcgtaata
ttgataggcctagtgctgatcgtaatcgcctactcgctgccagcgatagaggtgtactcc
agaggcttgagcccagccccgccctacaacccgctcacaggcgcccctgtgacgactagc
taa

DBGET integrated database retrieval system