KEGG   Pyrobaculum calidifontis: Pcal_2009Help
Entry
Pcal_2009         CDS       T00483                                 

Definition
RNA-3'-phosphate cyclase (EC:6.5.1.4)
Orthology
K01974  
RNA 3'-terminal phosphate cyclase (ATP) [EC:6.5.1.4]
Organism
pcl  Pyrobaculum calidifontis
Brite
Enzymes [BR:pcl01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.4  RNA 3'-terminal-phosphate cyclase (ATP)
     Pcal_2009
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1865071..1866114
Genome map
AA seq 347 aa AA seqDB search
MIRIDGSYGEGGGQILRTAIALSALLGVPVEVFNIRAKRANPGLQPQHLTGVNAAALLTD
AELEGAAKGSTRLVFKPKTIKCGGFQIDIGTAGSISLVIQTLTPIALFAPCPVRLSITGG
TDVAWAPPIDYMRFVFAPVVGRFGGRVKIEVLRRGHYPKGGGRVEVEVAPVDVLKPVDAV
DFGKVLKIRGISHAVNLPAHVAERQARAAAEALAKEGYAADISTEVRNDGLGPGSGVVLW
AESDVGNVVGGDALGERGKPAEAVGREAAEKLLTALKSGASVDSHMADMAVVYMALAEGV
SRITTPELTLHLQTNMYIVERFLPVKFRVEKLGQRHLIEVNGVGRRR
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
gtgattcgcattgacggatcgtacggggagggaggcggccaaattctccggactgccatt
gcactgtcggcacttttgggagtcccggttgaggtcttcaatattagggcgaagcgggcc
aacccaggcctacagccccagcacctcaccggcgtaaacgccgcggctctgttgacagac
gccgagctggagggggcggccaaggggtccactaggctggtgtttaagcccaagactatt
aagtgcggcggctttcagatcgacatcggcacggcgggtagcatctcgctggttattcag
acgttgactcccattgccctcttcgcaccgtgccccgtgaggctgagcatcacggggggc
accgacgtggcgtgggcgccgcccatagactacatgaggttcgtctttgcgccagtggtg
gggagatttggcggccgggttaagatcgaggtgttgaggcgggggcactaccccaagggc
ggcgggcgcgtggaggtggaggtggcgcccgtggacgtgctaaagcccgtcgacgcggtg
gactttgggaaagtgttgaagatccgcggtatttcgcatgccgtcaatctcccggcccac
gtggcggagaggcaggcaagggccgcggccgaggccttggccaaggaggggtacgccgcc
gacatctccaccgaggtgagaaacgacgggctgggccccggctctggggtcgtcctgtgg
gccgagtcagacgtgggcaacgtggtggggggagacgccctgggcgagagggggaagccc
gcggaggccgtggggagggaggccgccgagaagttgctcacggcgcttaagtcgggcgcc
tctgtggactcccacatggccgacatggccgtggtgtatatggccctcgcagagggcgtc
agccgcatcactacgccggagctcaccctgcacctccagacgaatatgtacatagtggag
cgctttctcccagtcaagtttagagtggagaagcttggccaacgccacttgatcgaggtc
aacggcgtgggccgccggcgctag

DBGET integrated database retrieval system