KEGG   Pyrobaculum calidifontis: Pcal_2020Help
Entry
Pcal_2020         CDS       T00483                                 

Definition
(GenBank) pyridoxal-phosphate dependent TrpB-like enzyme
  KO
K06001  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pcl  Pyrobaculum calidifontis
Pathway
pcl00260  Glycine, serine and threonine metabolism
pcl00400  Phenylalanine, tyrosine and tryptophan biosynthesis
pcl01100  Metabolic pathways
pcl01110  Biosynthesis of secondary metabolites
pcl01130  Biosynthesis of antibiotics
pcl01230  Biosynthesis of amino acids
Module
pcl_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pcal_2020
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pcal_2020
Enzymes [BR:pcl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pcal_2020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABO09435
JGI: pcal2020
UniProt: A3MXR8
Position
complement(1873582..1874946)
Genome map
AA seq 454 aa AA seqDB search
MRRSSTEEWMVPTRWYNIVPDLPKPLPPYLKPNGEPVAPKDFEMLFARELVRQEFSQERW
ISIPREVRDVYLIWRPTPLVRARRLEEALKTPARIYYKFEGVSPPGSHKPNTAVAQLYYV
SREGVGRVTTETGAGQWGSSVAFAASLFGVKATVYMVRASYLQKPYRRVLMELWGAEVVP
SPSDRTEAGRRFLSEDPNHPGSLGIAISEAVEDAVKNGAKYVLGSVLNHVLIHQTVIGLE
ALEQIRQFDDYPDYVVGACGGGSSFSGLFWPFYYEKKVGKAEKDVKFLAVEPKAVPTLTK
GEYLYDFGDTAGLTPLIKMFTIGHDYKPPPIHAGGLRYHGCAPTLSLLVAEGEVGAVAYG
QREVFEAAVLFARTEGVVPAPESAHAVKAAVELALAAKREGRPITILFNMSGHGLLDLAA
YDEYLRGALPDVEPSAEALAKHIEKVRQLQAARP
NT seq 1365 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaggtcgtcgacggaggagtggatggtccccactcggtggtacaacatagtgccc
gacctccccaagccgcttcctccgtacctaaagccgaatggggagccggttgcgcccaag
gacttcgagatgctcttcgccagggagttggttaggcaggagttttcgcaggagaggtgg
atatcgataccgcgggaggtcagagacgtgtacctgatatggaggcccacccctctggtg
agggccaggaggcttgaagaggccttgaagacccccgcgcgcatttactacaagttcgag
ggcgtctcgccgccgggctcccacaagcccaacacggcggtggcccagctctactacgtc
tcaagggagggcgtggggagagtgactacggagactggggccgggcagtggggctcctcc
gtcgccttcgccgcgtctctcttcggcgtaaaggccacagtctacatggtcagagcctcg
tatttgcagaagccgtataggcgggtgttgatggagctctggggggccgaggtggtgccg
agccccagcgacaggaccgaggccggccgtaggttcctctcagaggaccccaaccaccca
gggtctctgggcatagccatatccgaggccgtggaggatgcggtcaaaaacggcgcaaag
tacgtcctaggctccgtcttaaaccacgtcctgatacaccagacggtgataggcctcgag
gccctggagcagattaggcagttcgacgactacccggactacgtggtgggggcctgcggc
ggtgggagctccttctccggcctcttctggcctttctactacgagaagaaggtgggcaag
gcggagaaggatgtgaagttcctcgccgtggagcccaaggccgtgcccacgttgaccaag
ggggagtacctctacgacttcggcgacacggcgggcttgaccccgttgatcaagatgttc
accataggccacgactacaagccgcctcccatacacgccgggggccttagataccacggg
tgtgccccaacgctctccctcctggtggcagagggggaggtaggcgccgtggcgtacggc
cagagggaggtcttcgaggcggcggtgctcttcgccagaaccgagggcgtggttcccgcg
cctgagtctgcccacgcggtgaaggccgccgtggagcttgccctagccgcgaagagggag
gggaggccaatcacaatactcttcaacatgtcgggccacggcctcctagacctagccgca
tacgacgaatacctgcggggagctctgccagacgtggagccaagcgccgaggctctcgca
aagcacatagaaaaggttagacaactacaggcggcgaggccctag

DBGET integrated database retrieval system