KEGG   Pyrobaculum calidifontis: Pcal_2052Help
Entry
Pcal_2052         CDS       T00483                                 

Definition
pyruvate ferredoxin oxidoreductase, gamma subunit / pyruvate ferredoxin oxidoreductase, delta subunit (EC:1.2.7.1)
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Dicarboxylate-hydroxybutyrate cycle
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pcal_2052
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcal_2052
   00020 Citrate cycle (TCA cycle)
    Pcal_2052
   00620 Pyruvate metabolism
    Pcal_2052
   00640 Propanoate metabolism
    Pcal_2052
   00650 Butanoate metabolism
    Pcal_2052
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Pcal_2052
   00680 Methane metabolism
    Pcal_2052
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Pcal_2052
Enzymes [BR:pcl01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Pcal_2052
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1904013..1904951)
Genome map
AA seq 312 aa AA seqDB search
MRVETVWLGRGGQGIVTATYIIANAAVIDGLYAIANPEFGAERRGAPVKAFLTVSKDPIE
DQEPVKTPDVAVIFDDKLIDPMRFAIDAVKPGGYIILNTGKRPEEARKLVGRDDVYLVVL
DAIDIARRHLKLDIPNGPLAGAFAKVMGFPSLESIRQAFETQLGKAVEENFAATKEAYET
AVVIPPERVDKSAKPKGIISTTSAFLTGPYDIVGWQEVNKAGAVFPGTSFFYTTGGWRID
KPVIDHSKCIMCRKCWLYCPDDAIIEAWREVEGPRGRKFRMKFIDFDYAFCKGCGVCAEV
CPTGAIQMVREI
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtggagacagtctggctaggccgcggcgggcagggcattgtcacagccacgtac
attatagcaaacgccgcggtgatagacgggctctacgccattgccaaccccgagttcggc
gccgagaggaggggcgcccccgtcaaggcctttctcacagttagcaaagaccccatagag
gaccaagagccggtgaagacccccgacgtggccgtgatcttcgacgacaagttaattgac
ccaatgaggtttgccatagacgcagtcaagcctggcggctacataattctcaacacaggt
aagaggccagaggaggcgaggaagctcgtgggcagagacgacgtctacctagttgtgtta
gatgccatagacatagcaagacgtcacttgaagctggacattcccaacgggccgctggct
ggcgcctttgccaaggtgatgggcttcccctccctggagtccataagacaagcgtttgaa
acccagctggggaaggcggttgaggagaacttcgcggcaactaaggaggcctacgagacg
gctgtggtcatacccccagagagagtggacaagtcggctaagccgaagggcatcatatcc
acaacctctgccttcttgactgggccgtacgacatcgtgggctggcaagaggtgaacaag
gctggggctgtcttcccgggcacaagcttcttctacacgacggggggctggcgcattgac
aagccggtgatagaccactccaagtgtataatgtgccgcaagtgctggctgtactgcccc
gacgacgctataatagaggcctggagagaggtggaggggcccagggggaggaagttccgc
atgaagttcatagactttgactacgccttctgcaagggttgcggcgtgtgcgctgaggtg
tgcccaactggggcaatacagatggttagggagatatga

  All links  
No link information was found.   
DBGET integrated database retrieval system