KEGG   Pyrobaculum calidifontis: Pcal_2057Help
Entry
Pcal_2057         CDS       T00483                                 

Definition
Aldehyde ferredoxin oxidoreductase (EC:1.2.7.5)
Orthology
K03738  
aldehyde:ferredoxin oxidoreductase [EC:1.2.7.5]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:pcl01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:pcl00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1909815..1911728
Genome map
AA seq 637 aa AA seqDB search
MHFEIFKLSVRKYLNRKFMLNPMVVFRVLRVDLSTEKISEEVYKEDVVKKFLGGRGLGAY
LALKELPRGIDPLSPSNKLYIFAGPLSGTANLATSRINVVGKSPLTGSYTHSNAGGNFAY
WLRRSGYDGIIVEGAAEDPVYILVKDGEVSIRPAKHIWGKWTGSATKALLEDAGLEPDEK
KAGVMTIGPAGENLVRIAGLRFSDYERFAGRGGLGAVAGAKKLKGIVVWGTHDPMKDFVD
KQKFLKIATEYSVKLMNNATSKALHQYGTNLLANIINSIGGYPTRNFETGYFETAEKISG
EYIKQNYVKEVHGCMLCPIQCTQMAVVTSGPYKVPGEKIKYEYESTWALGGNLGLSQTEA
VLKMEKLANELGMDTISLGNTLGTFLELVKRGKIKYDIDWGDAGALIDLVYKTAYRDGIG
NDLAEGDWRLANKYGAPDAFVGSRGQGFPAYDPRALKGFAISYVTANRGGDHLEAYSPTW
EVLGVPEKVDPLCETPECISKQVRLVIYAQHLMALSDSVTYCKFDTLDKDGIFEQHLADL
FNAAYGWNVTGEDMLTIGERIFNVERLFHVKEGKWVKDELPPKMREPIKTGPAAGHTASK
MFDEGIKEFYKLRGWVDGKPTYETLKRLGLEEFQYLL
NT seq 1914 nt NT seq  +upstreamnt  +downstreamnt
atgcatttcgaaatatttaaacttagtgttaggaaatacttaaataggaagttcatgctt
aatcctatggtagtattcagagtactaagagttgatttgtcaacagagaaaataagcgaa
gaagtatataaggaggacgtcgtgaagaaattcctggggggaagggggctgggggcgtac
ttggcgttgaaggagttgccaaggggcatagacccgctctcgccctcgaataagttgtac
atattcgcggggcccttgtcgggcaccgccaacttggccaccagcaggataaacgtggtc
ggcaagagccccctgacgggttcctacactcactcaaacgcggggggcaacttcgcctac
tggcttaggaggagcggctacgacgggataattgtggaaggcgccgcggaggaccccgtg
tacatccttgtgaaagacggcgaggtgtccattaggcctgccaaacacatatggggcaag
tggacgggctcagccaccaaggccctgctagaggacgccgggcttgagcccgacgagaag
aaagccggcgtaatgaccatcggacctgctggggagaacctcgtgagaattgcgggcctc
aggttcagcgactacgagcgcttcgccgggagaggcgggctgggcgccgttgccggcgcc
aagaagctcaagggcatagtggtctgggggacccacgacccgatgaaggacttcgtggac
aagcaaaagttcctcaaaatcgccaccgagtactctgtaaagctcatgaataacgccact
tccaaggctttgcaccagtatgggacaaacctcttggccaacatcataaactccataggg
ggttaccccacgaggaacttcgagacggggtacttcgagacggcggagaaaataagcggg
gagtatatcaagcagaactatgtgaaggaggtgcacggctgtatgctttgtccaatccag
tgtactcagatggccgttgtgacctcagggccctacaaggtgcctggtgagaagataaag
tacgagtacgagtccacgtgggctctaggcggcaacctgggcctttcgcagaccgaggct
gtgcttaagatggagaagttggccaacgagctgggtatggacacgatatcgctgggcaac
acgctgggcaccttcctcgagcttgtgaagaggggcaagataaagtatgacatcgactgg
ggcgacgccggcgccttgatagacttggtgtacaagaccgcttatagagacggcattgga
aacgacttagccgagggcgactggaggctggcgaataagtacggcgcgcccgacgccttt
gtgggctccagggggcagggcttcccggcctacgaccccagagcgcttaagggcttcgcc
atttcgtacgtgacggccaaccgcggcggcgaccacctagaggcgtactcgcctacgtgg
gaggtgttgggcgttcccgagaaggtggacccgctctgcgagactcccgagtgtatttct
aagcaggtaaggctggtaatctacgcgcaacacttaatggctctctcagactcagtcaca
tattgcaagttcgacacgcttgacaaagacggcatatttgagcaacacctggcagacttg
ttcaacgccgcctatgggtggaatgtcacgggggaggacatgttgaccatcggggagagg
atattcaacgtggagaggctattccacgtgaaggagggcaagtgggtcaaggacgagctt
ccgcccaagatgagggagcctataaagactgggccagccgccggccacacggcgtcaaag
atgtttgacgagggcattaaggagttttacaagttgcgcggctgggtcgacggcaagccc
acatacgagactttgaagaggctagggctggaggagttccagtacctcttataa

DBGET integrated database retrieval system