KEGG   Pyrobaculum calidifontis: Pcal_2154Help
Entry
Pcal_2154         CDS       T00483                                 

Definition
aspartate carbamoyltransferase (EC:2.1.3.2)
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pcl  Pyrobaculum calidifontis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Brite
KEGG Orthology (KO) [BR:pcl00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Pcal_2154
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pcal_2154
Enzymes [BR:pcl01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Pcal_2154
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1991983..1992900)
Genome map
AA seq 305 aa AA seqDB search
MWFGRDVISARDFSREDLYELFEMAKYMEKFAKSRVDFLRGKVMATAFFEPSTRTRLSFE
VAMKRLGGDVIGFGSAEGTSVEKGETLADTIRMLDAYADVIVIRHKYEGAAKLAAEVAES
PVVNGGDGAYNHPTQAMLDVYTIWREFGHVDGLNVGLMGDLRNARTINSLVETLANFNVR
LYFISPEFLRPRAETVDYARDKGVKMSFHTNVEEVVHELDVLYVVRIQKERFLDPLEYER
VKGSYRVTLELLKNAKRGLIVLHPLPRVDEIDHRIDSTPHAKYFIQAALGVPLRMALIYL
ILSPP
NT seq 918 nt NT seq  +upstreamnt  +downstreamnt
gtgtggttcggtagagacgtaatttcggctcgggacttcagtcgagaagacttgtacgag
ctcttcgaaatggccaagtacatggagaagtttgcaaaatcgcgtgtagactttctcaga
ggcaaagttatggctacggcctttttcgagccatcaactaggactaggctcagcttcgag
gttgcgatgaagagacttggcggcgacgtcataggatttggaagcgcggagggcacaagc
gttgagaagggtgagacgctggctgacacgataaggatgttagacgcatacgccgacgtc
atagtaattaggcacaagtacgagggggccgccaagctggcggcagaggtggccgaaagc
cctgttgtcaatgggggcgacggggcgtacaaccaccccacgcaggccatgttagacgtg
tacacaatctggagggagttcggccacgttgacggcctcaacgtgggattgatgggcgac
ttgagaaacgccaggacgataaacagcctagtggagactcttgcgaatttcaacgttagg
ctctactttatttcgccagagtttttaaggccgagggccgagaccgtggactacgcgaga
gacaaaggcgtaaaaatgagctttcacaccaacgtagaagaggtggtacatgagctagac
gtgttatacgtggtcagaatacagaaagagcgctttttagacccactggagtacgaaaga
gtcaagggtagttatagggtaacactagagcttttaaagaacgccaagagggggcttata
gtgctacatccactgccccgggtcgacgaaatcgaccataggatagattctacgccacat
gcaaagtacttcatccaagcggcgctgggcgtgcctctgagaatggcacttatataccta
attctatctccgccatga

DBGET integrated database retrieval system