KEGG   Propionibacterium acnes 6609: TIB1ST10_00520Help
Entry
TIB1ST10_00520    CDS       T02065                                 

Definition
magnesium-chelatase 67 kDa subunit
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
pcn  Propionibacterium acnes 6609
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TIB1ST10_00520
Enzymes [BR:pcn01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     TIB1ST10_00520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(118209..120173)
Genome map
AA seq 654 aa AA seqDB search
MTYPFTAVVGQDEARLALLLCAVNPRIGGVILSGEKGTAKSTVVRGLVELLPGHIMRTLA
LGTTEDRLVGGLDLEATLVAGRSVLQPGLLSEVDGGVLYIDEVNLLDDHLVDLVIDACAG
TVRVEREGLTASLPSRFVLVGTMNPEEGALRPQLLDRFGLCIDVHGESDPAVRAEIIRRR
LDHDADPAEFDHRWQSDQNRQAAVIERARHIVAGVRLDEVVTELISCLCRQNHVAGHRAD
IVMAEATRAHAALVGRGVATEDDVLTISEMVLRHRRRVETPSESPPPRNQHPDDQPDQPE
QRPREPERPDPDVEKWQAGENLATPPSSSGEQQPEYHDGPQNQRDDGQHDPRKQPSGSGE
QVVAAGDPFAVRPLEPSQDRFARRACGRRLRTRSNDRRGRYVSARPTDRPDDLALDATLR
AAAVHQKSRRATERPDLAVHVKPIDWRAKVRAGRAASCVIFVVDASGSMGSRGRMTASKG
AVLSLLLDAYVKRDRVCLIGFRRDRAEVLVPVTSSVEVAQHGLAELPVGGRTPLSAGLIK
ACEVVRPLLLKDPGLRPLLILVTDGRGNVSLDGRPNSQATDEAIRVATKLGVDTRLSWVV
IDTEDPRGIQLSRARDIATALGGPCLRIDDLRADDLVNVVSRLDPSHQSPRKDR
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atgacctatccgttcaccgccgtcgtcgggcaggacgaagccagactcgctctgctgctg
tgcgcggtcaacccgcgtatcggtggggtcatccttagtggggagaagggaacggccaaa
tcgacagtggttcgtggtctcgtcgagctgttacccggtcacatcatgcgcaccctggct
ctgggaaccaccgaggatcgtcttgtcggcgggttggacctggaagccaccctggtggcg
ggacgctccgtcctccagccgggtctgcttagcgaggtcgacggaggggtgctctacatc
gacgaggtcaacctcctcgacgaccacctcgtcgatctcgtcatcgacgcctgcgccggg
accgtgcgggtggagcgtgagggattgacggcctccctgccgagccgattcgtgctggtg
ggaaccatgaaccccgaggagggggcactgcgtccgcagttgttggaccggttcggactg
tgcatcgacgtgcacggcgagtccgacccggccgtccgggctgagatcatccggcggcgt
ctcgaccacgacgccgatccggccgagttcgaccaccgctggcagagcgaccagaaccgt
caggccgcagtcatcgagagggcgcggcacatcgtcgccggagtccgactggacgaggtc
gtcaccgaactcatctcctgcctgtgtcggcagaaccacgttgctgggcaccgcgccgac
atcgtcatggccgaagccacgcgggctcatgccgccctggtcggtcgcggcgtcgccacc
gaggacgacgtgttaacgatcagcgagatggtactgaggcaccgccgtcgcgtcgagacc
ccgtcggagtctccgccgccgcgcaaccagcaccccgacgatcagccggaccagcccgaa
caacgtccccgggaacccgagcgacccgaccccgacgtggaaaaatggcaggcgggcgag
aatcttgccacgccgcccagcagttcaggcgaacaacaacccgaataccacgacggtccc
cagaaccagcgagacgacggccagcacgacccgcggaaacaaccctcgggcagcggtgaa
caggtggttgccgccggggacccgttcgccgtccgccccttggaacctagtcaggaccgc
ttcgcccgtcgcgcctgcggacgacgtctgcgcacccgcagtaacgatcgacgtggccgc
tacgtctcagcccgacccaccgaccgccctgacgacctcgccctggacgccacccttcgc
gcggcggcggttcatcagaagtcacgtcgggccaccgagcgtccagacctggcggtgcac
gtcaaaccgatcgactggcgggccaaagtacgggccggacgagccgcctcctgcgtgatc
ttcgtagtcgacgcttccgggtcgatggggtcacgaggacgaatgaccgcctctaagggg
gccgtgctgtccctcctcttggacgcctacgtcaagcgtgatcgggtgtgccttatcggt
ttccgccgcgaccgggccgaggtgctggtgccggtgacctcctcggtggaggtagcccag
cacggtttggcagagctaccggtcggtgggcgcaccccgctgtcggccggactgattaag
gcctgcgaggtggtacggcccctgctcctcaaggaccccgggctgcgaccattactcatc
ctcgtcaccgacgggcgcggcaacgtcagtctggacggccgtcccaactcccaggccacc
gatgaggcgattcgggtggcaaccaagctcggcgtcgacacacgactcagctgggtcgtc
atcgacaccgaggacccacgaggtatccagctgtctcgggcccgcgacattgccacagcc
ttgggtggaccttgtctgcgcatcgacgacctgcgggctgacgacctcgtcaacgtcgtc
tctcgacttgacccctcccaccaatctccccgaaaggaccgctga

DBGET integrated database retrieval system