KEGG   Propionibacterium acnes 6609: TIB1ST10_00725Help
Entry
TIB1ST10_00725    CDS       T02065                                 

Definition
(GenBank) 1-phosphofructokinase
  KO
K16370  6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
pcn  Propionibacterium acnes 6609
Pathway
pcn00010  Glycolysis / Gluconeogenesis
pcn00030  Pentose phosphate pathway
pcn00051  Fructose and mannose metabolism
pcn00052  Galactose metabolism
pcn00680  Methane metabolism
pcn01100  Metabolic pathways
pcn01110  Biosynthesis of secondary metabolites
pcn01120  Microbial metabolism in diverse environments
pcn01130  Biosynthesis of antibiotics
pcn01200  Carbon metabolism
pcn01230  Biosynthesis of amino acids
Module
pcn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIB1ST10_00725
   00030 Pentose phosphate pathway
    TIB1ST10_00725
   00051 Fructose and mannose metabolism
    TIB1ST10_00725
   00052 Galactose metabolism
    TIB1ST10_00725
  Energy metabolism
   00680 Methane metabolism
    TIB1ST10_00725
Enzymes [BR:pcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TIB1ST10_00725
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PfkB
Motif
Other DBs
NCBI-ProteinID: AEH28457
Position
complement(171619..172569)
Genome map
AA seq 316 aa AA seqDB search
MIVTVTLNPSIDRTAPIAGPLRRGQVNRLGSSTEVAAGKGVNISRVLRGAGIETCAVVPA
GAKGRLTLGLNHDDIPHQVVPVAAAVRTNLTITEPDGTTTKINEPGADLSPEELTAVEEA
IVEKSSGAQWVVLSGSLPPGVPTHWYATMTDRLHEIGVKVAVDTSDQPLQELAARLPDCA
PDLVKPNSVELGQLCGIDGDSLESAATRGQFDDVVVAARGLHGIAEVIVTLGGTGALLIT
EHDAWHARPEPVEVKSTVGAGDSSLAGFLLARTRGDQPENCLRAAVAWGTAAAALPGSTM
PTPSQADAIHVSLTHL
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgtcaccgtcacgctcaacccgagcattgaccgcacagcgcccatagctgggccg
ctgcggcgcggtcaggtgaaccgactcggcagttccaccgaggtcgccgccggtaagggg
gtcaacatctcgcgagtccttcgtggggctggaatcgaaacctgcgccgtggtgccagcc
ggagccaagggccgcctgaccctcggcctcaaccacgacgacatcccgcaccaagttgta
cccgttgcggcagcggtgagaaccaacctcaccatcaccgaacctgacggcactacaacc
aagatcaatgagcccggagccgacctcagtcctgaggagctgaccgcagttgaggaggcc
atcgtcgagaagtcctccggcgcgcaatgggtcgtactgtcaggatccttacccccgggc
gtacccacacattggtatgccacaatgaccgaccgcctccatgagatcggcgtcaaagtc
gccgtcgacacctccgatcaacccctccaagagctggcggcccgcctccccgactgtgcc
cctgaccttgtcaagccgaactccgtcgagctcggccaactatgcgggattgacggcgac
tctctcgagtctgctgccacaaggggacagttcgacgacgttgtcgtggccgcccgaggt
ctgcacggcatcgccgaggtaatcgtcaccttgggcgggaccggcgctctgctcatcacc
gaacacgacgcctggcacgcccggccagagccggtcgaggtgaagtcgactgttggcgcc
ggagactcctccctggccggattcctgctggcgcgcacccgcggcgaccagcccgaaaac
tgcctgcgcgccgccgtggcgtggggcacagcagccgccgctctaccggggtcaaccatg
ccgaccccgtcacaggccgacgccattcacgtcagcctcacccacctgtaa

DBGET integrated database retrieval system