KEGG   Propionibacterium acnes 6609: TIB1ST10_01075Help
Entry
TIB1ST10_01075    CDS       T02065                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
pcn  Propionibacterium acnes 6609
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pcn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
256300..256905
Genome map
AA seq 201 aa AA seqDB search
MYDGPLQELIDALSRLPGIGPKGAQRIAFHILDAPAEEANELADALREVKEKAKFCKICF
NVSSDEVCQYCRDPRRDQSMICVVEESKDVIAVERTRQFRGLYHVLGGAISPLDGKGPAD
LHIRELCQRLADETVTEVILATNPNLEGEATATYLSRLIAPMGVTVSRLASGLPVGGDLE
YADEVTLGRAFEGRLHVGVGA
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgtacgacggtccgctgcaagaactcattgacgccctttctcggctaccggggatcggg
ccgaagggtgcgcagcggatcgcttttcatatcctcgacgctcctgcggaggaggccaat
gaactggccgacgccttgcgcgaggtcaaagagaaggccaagttctgcaagatttgtttt
aatgtctcctccgatgaggtgtgccagtactgccgtgatccgcgtcgggaccagtcgatg
atctgtgttgttgaggagtccaaagacgttattgctgtggagcgtacccgacaattccgt
ggtctgtatcacgttcttggcggagcgatctcgccgttagacggaaaaggcccagctgat
ctccacatccgtgaattgtgccagcggttggctgacgaaaccgttaccgaggtgatcctg
gccaccaacccgaaccttgagggggaagcaacggcaacgtatctttcccgcctcatcgcg
cccatgggcgtgacggtgtcccgactagcctctggtttgccggttggcggcgacctggaa
tacgccgacgaggtcaccctggggcgcgccttcgagggacgcctccatgtgggagttggt
gcctga

DBGET integrated database retrieval system