KEGG   Propionibacterium acnes 6609: TIB1ST10_01365Help
Entry
TIB1ST10_01365    CDS       T02065                                 

Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
pcn  Propionibacterium acnes 6609
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TIB1ST10_01365
Enzymes [BR:pcn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     TIB1ST10_01365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
315630..316199
Genome map
AA seq 189 aa AA seqDB search
MSVDRERAAAAIREFLLAVGEDPDREGLRDTPMRVAQAAEELFGGLSQDPGELLATTFDI
SHDEMVLVRDIELQSMCEHHLLPFIGVAHVGYIPARDGRVTGLSKIARLVEVYARRPQVQ
ERLTTQVADALVEHLDARGVIVVVEAEHMCMTTRGVRKPGARTVTSAVRGILRNPATRAE
AMGLITAGR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
ttgtccgttgatcgcgagcgagccgcggcagctatccgcgagtttcttctggcggtcggc
gaggatcccgatcgggaaggcctgcgcgatactccaatgcgagtggcccaggcggccgag
gagctatttggcggattgagccaagatccgggggagttgctggcaacgaccttcgacatc
tcccacgacgagatggtgttggtgcgtgatattgagttgcagtcgatgtgtgagcaccat
ctgctgcccttcatcggggtagcgcacgtcggttatattccggctagggacggccgggtg
acggggttgagtaagatcgcgaggttggtggaggtctatgcgcgtcgaccccaggtacag
gagaggttgacgacccaggtggccgacgccttggtagaacatttggacgctcgtggcgtg
atcgtggttgttgaggccgagcacatgtgcatgacgacgaggggggtccgcaagccgggg
gcccggacggtgacctccgcggtgcgcgggattctgcgcaacccagcgacgcgggccgag
gcgatggggctgatcacggctggacgttga

DBGET integrated database retrieval system