KEGG   Propionibacterium acnes 6609: TIB1ST10_01560Help
Entry
TIB1ST10_01560    CDS       T02065                                 

Definition
(GenBank) delta-aminolevulinic acid dehydratase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
pcn  Propionibacterium acnes 6609
Pathway
pcn00860  Porphyrin and chlorophyll metabolism
pcn01100  Metabolic pathways
pcn01110  Biosynthesis of secondary metabolites
pcn01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TIB1ST10_01560
Enzymes [BR:pcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     TIB1ST10_01560
Exosome [BR:pcn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TIB1ST10_01560
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD OMS28_porin
Motif
Other DBs
NCBI-ProteinID: AEH28624
Position
complement(352404..353450)
Genome map
AA seq 348 aa AA seqDB search
MNPYLPDASDPRMAGVKPLPEGLRPVSRPRRLRTTPAMRRMVAETRVAPAQLMLPAFVKE
GIDSPVEITSLPGQFQHSTESIKELATQAAEAGIGGIDLFGIPEHKDEIGSQAWDLKGIL
NAGISAVREAVGDDLVICADTCLDEFTDHGHCGALTPDGRVDNDSTVPLYAAMAVSQARA
GAHMVSPSGMMDGQIAVIRDTLDREGFTDVSIMAYSAKYASAFFGPFRDAVNCSLKGDRK
TYQQDPPNRREGLRETLLDLAEGADLVMVKPASHYLDVLSDVAEVSQVPVAAYQVSGEYA
MLEAAAANGWIDRRRCIGESLTSIVRAGADLVLTYWAIEAAQMFREDL
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaacccgtacctgcctgatgccagtgatccccgcatggctggggtcaagccattgccc
gaggggctgcgtcctgtttctcgtccgcgtcgactacgcaccactcctgcgatgcgccgg
atggtcgccgaaacccgcgtcgcccccgcccagttaatgctgccggcgttcgtcaaagag
gggatcgattcccccgtcgagatcaccagcctgcccggccaattccagcactccaccgag
tcgatcaaggagctcgccacccaagctgccgaggccggtattggtggtattgacctgttt
ggtatcccggagcacaaagacgagatcggttctcaggcctgggacctgaaaggcatcctc
aacgccggcatctccgcggtgcgcgaggccgtcggcgacgatctggtgatctgtgccgac
acctgtctagacgagttcaccgatcatggacactgcggagctctgacccctgatggtcgc
gtcgataatgactccactgtgccgctatatgccgcgatggcggtctcccaagcgcgcgcc
ggagcccacatggtctccccgtcggggatgatggacggtcagatcgctgtcattcgcgat
actctggatcgcgagggattcaccgatgtgtccatcatggcctattcagctaagtacgct
tcagccttctttggccccttccgcgacgccgtcaactgttcccttaagggtgatcgcaag
acttaccagcaggatccaccgaaccgccgggaaggcctgcgcgaaacccttctcgacctc
gccgagggagccgacctggtcatggtgaagcccgcctcccactacctcgacgtgttgtcc
gatgtcgccgaggtgtcgcaggtaccggttgccgcttaccaggtctctggagaatacgcc
atgctcgaggccgctgccgcaaacggttggatcgatcgtcgacgttgcatcggagagtcc
ctgacctcgatcgtgcgtgccggtgccgatcttgtcttgacctactgggcaatcgaggcg
gcgcagatgtttcgcgaggacctctga

DBGET integrated database retrieval system