KEGG   Propionibacterium acnes 6609: TIB1ST10_02510Help
Entry
TIB1ST10_02510    CDS       T02065                                 

Definition
UTP--glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pcn  Propionibacterium acnes 6609
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    TIB1ST10_02510
   00052 Galactose metabolism
    TIB1ST10_02510
   00500 Starch and sucrose metabolism
    TIB1ST10_02510
   00520 Amino sugar and nucleotide sugar metabolism
    TIB1ST10_02510
Enzymes [BR:pcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     TIB1ST10_02510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
540109..541506
Genome map
AA seq 465 aa AA seqDB search
MSEEGLAAARQKMTEAGVDPVAIEVFTSYYHQLETGDTGLIREDTISPLTNPPMLDDVEV
SEEQAAEALDKTVIIKLNGGLGTSMGLDRAKSLLEVRDGKSFLDIIATQVLSARKTFGAR
LPLMFMNSFNTREDTLKALEKYPELAVDGLELDFLQDQEPKLDAETLAPVEWPKDSSLEW
CPPGHGDLYTALLGSGVLDHLLEAGYQYASVSNGDNLGAVPDGRLAGWFAASGAPYAAEL
CRRTINDKKGGHLAIRKSDDQLILRDTAQTAEEEMDYFTDEHRHPFFHTNNLWFDLEALK
KVLDERHGVMGLQIIRNEKTVDPKDSSSTPVIQIESAMGGAIEVFEGATCICVDRSRFLP
VKTTNELLLLRSDVYDLDDSDHLVKTTDMTCAVDLDKDFYKKISDFDDRIPEPPSLRRAT
SLKVKGDWTFGSEVVVAGDVSLDTEKPQTIPDGTVLTGEVLGAKK
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaagaaggacttgcggctgcacgccagaagatgaccgaggcaggtgtcgatcct
gtcgccatcgaggtcttcacttcctactaccaccagctcgagaccggcgataccggactc
atccgcgaggacaccatctccccgctcacgaatccgccaatgctcgacgacgttgaggtc
agcgaggagcaggctgctgaggccctcgacaagaccgtcatcatcaagctcaatggcggg
ctcggaacctcgatgggcctcgaccgagctaagtcgctgctcgaagttcgtgacggcaag
tccttcctcgacatcatcgctacccaggtgctctcggctcgcaagactttcggcgctcga
ttgccgctgatgttcatgaattccttcaatacccgcgaggacaccctcaaggccctcgag
aaatatccagagttggctgtcgacggcctagagctcgacttcctgcaggatcaggagcct
aagctcgacgctgagaccctcgccccggttgagtggccgaaggactcctccctcgagtgg
tgtcctccgggtcacggcgacctctacaccgctctgcttggatccggcgtcctcgaccat
ctgctcgaggctggataccaatacgcctcggtatccaatggtgacaatcttggtgccgtt
ccggacggtcgtctcgccggctggtttgcggcgtcgggtgctccctacgctgccgagttg
tgccgtcgcactattaacgacaagaagggtggccacctggccattcgtaagtctgatgat
cagctcatcctgcgcgatacggcacagacagcagaagaggaaatggattacttcaccgac
gagcatcgtcaccccttctttcacaccaacaatctgtggtttgaccttgaagccctcaag
aaggtgctggacgagcgacacggcgtgatgggcctgcaaattattcgcaacgagaagacg
gtcgacccgaaggattcctcgtcgactcctgtcatccagattgagtccgctatggggggc
gctatcgaggtctttgaaggcgctacctgtatctgtgttgatcggtcccggttcttgccg
gtcaaaacgaccaacgagctgctgctgcttcggtctgatgtttatgacctcgacgattcg
gaccacctcgtcaagaccaccgacatgacctgcgcagtcgatcttgacaaggatttttat
aaaaagattagtgatttcgacgatcgcatccctgagccgccatcgctgcgccgcgccacc
tcgctgaaggtcaaaggagactggacctttggttcggaggttgtcgttgcgggggatgtt
tcgctggatactgagaagcctcagacgattccggacgggaccgtgctcactggcgaagtc
cttggcgcgaaaaagtga

DBGET integrated database retrieval system