KEGG   Propionibacterium acnes 6609: TIB1ST10_03285Help
Entry
TIB1ST10_03285    CDS       T02065                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pcn  Propionibacterium acnes 6609
Pathway
pcn00300  Lysine biosynthesis
pcn01100  Metabolic pathways
pcn01120  Microbial metabolism in diverse environments
pcn01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TIB1ST10_03285
Enzymes [BR:pcn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     TIB1ST10_03285
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28 Oxidored_q6
Motif
Other DBs
NCBI-ProteinID: AEH28965
Position
701665..702744
Genome map
AA seq 359 aa AA seqDB search
MDLKPAGDLHELFRRLVDIESVSMHEAPIADAVEETLAPHRHLEVTRLGNSVVARTHLGR
SERVVIAGHLDTVPVVENLPSYIEQRSDGDYLVGRGTCDMKGGIAVALALAVSLENPVRD
VTWAFYECEEIAAEHNGLEKIASWRPDLIDGDFAILMEPTDGRVEGGCQGTMRFTLEVPG
RAAHSARSWVGHNAIHDLSAVLERLNRWQERDPFVEVDGLTFREGLNATMLDAGVAGNVI
PPTATIQINYRFAPDKTTEQARQYMEDLFHEWPMNVLDLSAPARPGLDRPLAKSFVAAVG
GEPGPKYGWTDVARFGQLGIPAVNFGPGNALCAHQVDECCRLGSLDECYRALHTWLASR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atggacttgaagccggcgggcgacctgcacgagctctttcgtcgactcgtcgacatcgag
tcggtgtccatgcacgaggcgcctattgccgatgctgtggaggagacgttggcaccacat
cggcatcttgaggtgacgagactcggtaactctgtcgttgcccgtactcaccttgggcgt
tcggaacgggtcgtcattgctggtcacctcgacaccgttccggtcgtcgagaacttgccg
tcctatattgagcagcggtcggacggggattacctcgtgggtaggggcacgtgcgacatg
aagggcggtatcgccgtcgcgctcgccttggctgtgagccttgagaatccggtgagggat
gtcacttgggcgttctatgagtgtgaggagatcgcggccgagcacaacggcctggagaag
attgcctcttggcgccctgacctcatcgacggtgacttcgccatcctcatggaacccacc
gatggccgggtggagggtggttgtcagggaaccatgcgtttcacccttgaggtgccgggg
cgggcggcccattcagctcgttcgtgggtcgggcacaatgcgatccatgatctgtccgcc
gttttggagcgtctcaaccgctggcaagaacgggacccgtttgttgaggttgacgggctg
accttccgtgagggcctcaatgcgacgatgctcgacgccggtgtggccggtaacgttatt
ccccccaccgctactattcagattaattatcggttcgcccccgacaagacgaccgaacag
gctcggcagtacatggaggatctcttccatgagtggccgatgaacgttcttgacctgtcg
gctcccgccagaccagggctcgatcgtccgttggcgaagtctttcgttgctgcggtgggc
ggggaaccgggtcctaagtacgggtggaccgacgttgcccgtttcgggcaactcggaata
ccggctgttaacttcgggccggggaatgcgctgtgcgctcatcaggtggatgagtgttgt
cgtcttggctcactggatgagtgctaccgggcgctgcacacgtggttagcgtcgcgatga

DBGET integrated database retrieval system