KEGG   Propionibacterium acnes 6609: TIB1ST10_03580Help
Entry
TIB1ST10_03580    CDS       T02065                                 

Definition
dihydrolipoamide acyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pcn  Propionibacterium acnes 6609
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TIB1ST10_03580
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    TIB1ST10_03580
  Amino acid metabolism
   00310 Lysine degradation
    TIB1ST10_03580
Enzymes [BR:pcn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     TIB1ST10_03580
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(765086..766459)
Genome map
AA seq 457 aa AA seqDB search
MSTEVTLPALGESVTEGTVSRWLKAVGDTVEADEPLLEVSTDKVDTEVPSPASGTLLEIK
VPEDEDAEVGAVLAIIGDPSESGSAPAKPTAEPAEKAKPEPVKSEAEEAPAPAAPKPAEA
PKPAGTNEVAPRATNPSSDVYVTPLVRKLARENNVDLSTITGTGVGGRIRKQDVLAAAGK
SGEAPSAPQAPAAAPAPAAPKPAGSARKASQEVSPEAAALRGTTEKMSRLRKVIASRMVE
SLQISAQLTATVEVDMTAISRIRNAEKAAFKAREGVGLSYLPFITKAVVEALKANPTFNA
NIDTEAGTITYGSSENIGIAVDTPRGLLVPVIKNAGDLNIAGLAHQIGDLAARTRDNKVT
PDELSGGTFTITNYGSAGALFDTPIVNQPEVAILGTGALVKRPVVVTNEFGEDTIAVRDM
MYLSLSYDHRLIDGAVAARFLSGIKARLEEGDFAGEF
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgaagtcactcttcctgcactgggcgagtccgtcaccgaaggcaccgtgtcc
cgctggctcaaggctgtcggagacaccgtcgaggccgacgaacccttacttgaggtgtcc
accgacaaggtcgataccgaagtcccctcccccgcctccggcaccctacttgagatcaag
gtccccgaagacgaagacgccgaagtcggcgccgtcctagccatcatcggcgacccctcc
gagtcgggctctgcgcctgctaagccgacggctgagcccgcggaaaaggccaaacctgag
ccggtgaagagcgaggccgaggaggcaccggcgccggccgcgccgaagcccgccgaggct
cccaaacccgccgggaccaatgaggtcgccccacgcgccaccaatccgtcgtcggacgtc
tacgtcaccccgctagtccgcaagctcgcccgggagaacaacgtcgacctgtcgacgatc
accggaactggtgtcgggggtcgtattcgcaagcaagacgtactagctgcagccggtaag
tctggagaagctccctcagctcctcaggcaccggctgccgcccctgccccggctgctccg
aaaccggctggttcagcccgtaaagcctcccaggaagtctctccggaagctgccgctctg
cgcggcaccaccgagaagatgagccgtctacgcaaggtcatcgcctcgcggatggttgag
tccctgcagatctcggctcagttgacggccaccgtcgaggtggacatgaccgctatctcc
cgcatccgcaacgctgagaaggctgctttcaaggcccgcgagggagtcggtctgtcctac
ttgcctttcattaccaaggccgtcgttgaagccctcaaggccaatccgaccttcaacgca
aatatcgacaccgaggcggggacgattacctacggttcttctgagaacatcggcatcgcc
gttgataccccgcgcgggctgctggttccggtcatcaagaacgctggtgatctcaatatc
gctgggctggcccaccagattggcgatctcgctgcccgcacccgcgacaacaaggtgacc
cctgacgagctgtccggcggcaccttcaccatcaccaactatggctcggctggagccctc
ttcgacaccccgatcgtcaaccagcccgaggtcgccatcctcggcaccggtgctctggtt
aagcgcccggtcgtcgtcaccaacgagttcggcgaggataccatcgcagtccgcgacatg
atgtacctctcgctgtcctacgatcaccggctcattgacggcgctgtggcggctcgcttc
ctatcgggcatcaaggctcgtctggaggagggcgacttcgccggagagttctga

DBGET integrated database retrieval system