KEGG   Propionibacterium acnes 6609: TIB1ST10_03730Help
Entry
TIB1ST10_03730    CDS       T02065                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
pcn  Propionibacterium acnes 6609
Pathway
pcn00010  Glycolysis / Gluconeogenesis
pcn00052  Galactose metabolism
pcn00500  Starch and sucrose metabolism
pcn00520  Amino sugar and nucleotide sugar metabolism
pcn00521  Streptomycin biosynthesis
pcn01100  Metabolic pathways
pcn01110  Biosynthesis of secondary metabolites
pcn01120  Microbial metabolism in diverse environments
pcn01130  Biosynthesis of antibiotics
pcn01200  Carbon metabolism
Module
pcn_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
pcn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIB1ST10_03730
   00052 Galactose metabolism
    TIB1ST10_03730
   00500 Starch and sucrose metabolism
    TIB1ST10_03730
   00520 Amino sugar and nucleotide sugar metabolism
    TIB1ST10_03730
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    TIB1ST10_03730
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    TIB1ST10_03730
Enzymes [BR:pcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     TIB1ST10_03730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK BcrAD_BadFG Glucokinase Hydant_A_N FGGY_N GST_N_2
Motif
Other DBs
NCBI-ProteinID: AEH29054
Position
794201..795271
Genome map
AA seq 356 aa AA seqDB search
MLSVGIDIGGTKVAAGVVDESGQIVRRIQRLTPSRSPEAVEDAIVESVRELARNLPICAV
GIGAAGWIDTEQALVRFSPHLAWRNEPLRDRLSERITVPVLVDNDANAAAWAEFRFGAGQ
GSRVMVCLTLGTGIGGALVINGRMFRGRYGMAGEFGHMTVVPDGHWCPCGNRGCWEQYAS
GNSLVRDARALLAEGAPGAQDLLGYVADRNPDNLIGPDVTRAAVDGDRLAIELIADIGIW
LGRGMANLAAALDPDLFVIGGGVSAAGDLLLEPARTVYARTLTGRGFRPMADIQKAHFGN
DAGLIGAADLARHSINEPPGMARGFWPRRRTAVRKPRRTLRQSLSETLAGPVVRDK
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
ttgcttagcgttggcatagatattggcggcacgaaggtcgccgctggtgtcgtagatgaa
agtggccagattgttcggcgtattcagcgcctgacaccctcgcgcagccccgaggctgtt
gaggacgctatcgttgagtcggtccgtgaactggctcgtaaccttcctatctgtgctgta
ggcatcggggcagccggctggatagacactgagcaggcgctcgtgcggttttccccgcat
ttggcatggcgtaatgagccgctgcgcgatcgtctgtctgagcgcatcactgtgcctgtt
ctcgtcgataatgacgccaatgcggctgcgtgggctgagttccggtttggagccggacaa
ggatcacgggtcatggtgtgcctgacgttgggaacgggtatcgggggtgcactcgttatc
aatgggcggatgttccgcggccgatacggcatggccggagaattcggacatatgacggtg
gttcccgatggccactggtgcccatgtggcaaccgtggttgctgggagcaatacgcctct
ggaaattccctcgtgagggacgctcgagcgttgcttgccgagggagctcccggtgctcag
gacctgttgggttatgtagctgaccgcaatcccgataacctcattggtcctgatgtcaca
cgcgcagcggtcgatggcgatcgtcttgctattgagctcattgcagacattggcatctgg
ctgggccgtggaatggcgaacttggcagcagccttagatccagatctctttgtcattggt
gggggagtgagcgccgccggagacctcttgcttgaacctgcgcgcactgtatatgcccgc
acgctgacgggtcgggggttccgcccgatggccgatattcagaaggcacatttcggtaac
gatgctgggcttatcggcgccgcagacttggctcgccactccatcaacgaaccgccgggc
atggctcgcgggttctggccacgtcgtcgtactgctgttcgcaagccacgccgtactttg
cgtcagagcctgagtgaaactctcgccggcccggttgttcgggacaagtga

DBGET integrated database retrieval system