KEGG   Propionibacterium acnes 6609: TIB1ST10_04065Help
Entry
TIB1ST10_04065    CDS       T02065                                 

Definition
magnesium-chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pcn  Propionibacterium acnes 6609
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pcn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(867394..868215)
Genome map
AA seq 273 aa AA seqDB search
MPTISQVDDVYHLSADEQHIYGDPLGVPSCTNLQLRQVPVVELPVGVTEDRVAGTLDVET
ALVRGQQRFQPGLLASAHRGILYVDEVNLLDDHIVDILLDSAAMGVNTVEREGMSVIHPS
RFSLVGTMNPEEGQLRPQLLDRFGLCVTVQGETDPEVRMEIVQRRLSFEDDPDGFITEWS
SHSRRLAERIENAMTLVQSVEIPKNILSTAVQICLDSNIDGHRGDITIIHAARALAAWAG
RDRIIQADLEKVAPLVLNHRLQYASGVARAPRG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccatttctcaggttgacgacgtttatcatctgagcgctgatgagcaacatatc
tacggagatcctttaggggttccaagctgcacaaatctacagcttcggcaagttccagta
gtggagctaccggttggggtcaccgaagacagggttgccgggacacttgacgtagaaaca
gccttagtccgggggcagcaaaggttccagccaggcctgctagcgtcggcacaccgagga
atactgtacgtcgatgaggtcaatcttcttgacgatcacatcgtcgacatcttgctggat
tctgcagctatgggagtgaataccgttgaacgggaaggcatgagcgtgatccatccatcc
cgtttcagcttggtaggaacgatgaatcccgaagaaggccagctacgtccacaattgctg
gatcggttcggactgtgcgttacggtccagggagagaccgatcccgaggtacggatggag
atcgtacaacgtcgactatcattcgaagacgatccggatggatttattacagaatggtcc
tcgcatagcagacgattagccgaacgcatcgaaaatgccatgaccctagtccaatccgtc
gagattccgaaaaatattctttccacagcggtacagatctgtctggattccaacatcgac
ggccatcgaggcgacatcaccatcattcacgccgcaagagccttagcagcgtgggcggga
cgagaccgaattattcaggccgatctcgaaaaagtcgcccccctggtcctcaatcatcgg
ttacaatatgcgtcgggcgtcgcgcgggctccacgcggatag

DBGET integrated database retrieval system