KEGG   Propionibacterium acnes 6609: TIB1ST10_04065Help
Entry
TIB1ST10_04065    CDS       T02065                                 

Definition
magnesium-chelatase subunit ChlI
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
pcn  Propionibacterium acnes 6609
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    TIB1ST10_04065
Enzymes [BR:pcn01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     TIB1ST10_04065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(867394..868215)
Genome map
AA seq 273 aa AA seqDB search
MPTISQVDDVYHLSADEQHIYGDPLGVPSCTNLQLRQVPVVELPVGVTEDRVAGTLDVET
ALVRGQQRFQPGLLASAHRGILYVDEVNLLDDHIVDILLDSAAMGVNTVEREGMSVIHPS
RFSLVGTMNPEEGQLRPQLLDRFGLCVTVQGETDPEVRMEIVQRRLSFEDDPDGFITEWS
SHSRRLAERIENAMTLVQSVEIPKNILSTAVQICLDSNIDGHRGDITIIHAARALAAWAG
RDRIIQADLEKVAPLVLNHRLQYASGVARAPRG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgcctaccatttctcaggttgacgacgtttatcatctgagcgctgatgagcaacatatc
tacggagatcctttaggggttccaagctgcacaaatctacagcttcggcaagttccagta
gtggagctaccggttggggtcaccgaagacagggttgccgggacacttgacgtagaaaca
gccttagtccgggggcagcaaaggttccagccaggcctgctagcgtcggcacaccgagga
atactgtacgtcgatgaggtcaatcttcttgacgatcacatcgtcgacatcttgctggat
tctgcagctatgggagtgaataccgttgaacgggaaggcatgagcgtgatccatccatcc
cgtttcagcttggtaggaacgatgaatcccgaagaaggccagctacgtccacaattgctg
gatcggttcggactgtgcgttacggtccagggagagaccgatcccgaggtacggatggag
atcgtacaacgtcgactatcattcgaagacgatccggatggatttattacagaatggtcc
tcgcatagcagacgattagccgaacgcatcgaaaatgccatgaccctagtccaatccgtc
gagattccgaaaaatattctttccacagcggtacagatctgtctggattccaacatcgac
ggccatcgaggcgacatcaccatcattcacgccgcaagagccttagcagcgtgggcggga
cgagaccgaattattcaggccgatctcgaaaaagtcgcccccctggtcctcaatcatcgg
ttacaatatgcgtcgggcgtcgcgcgggctccacgcggatag

DBGET integrated database retrieval system