KEGG   Propionibacterium acnes 6609: TIB1ST10_04695Help
Entry
TIB1ST10_04695    CDS       T02065                                 

Definition
(GenBank) acetyl-CoA synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pcn  Propionibacterium acnes 6609
Pathway
pcn00010  Glycolysis / Gluconeogenesis
pcn00620  Pyruvate metabolism
pcn00640  Propanoate metabolism
pcn00680  Methane metabolism
pcn01100  Metabolic pathways
pcn01110  Biosynthesis of secondary metabolites
pcn01120  Microbial metabolism in diverse environments
pcn01130  Biosynthesis of antibiotics
pcn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIB1ST10_04695
   00620 Pyruvate metabolism
    TIB1ST10_04695
   00640 Propanoate metabolism
    TIB1ST10_04695
  Energy metabolism
   00680 Methane metabolism
    TIB1ST10_04695
Enzymes [BR:pcn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TIB1ST10_04695
Lipid biosynthesis proteins [BR:pcn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TIB1ST10_04695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding
Motif
Other DBs
NCBI-ProteinID: AEH29236
Position
991634..991819
Genome map
AA seq 61 aa AA seqDB search
MVGDGTCPITDTWWQTETGMFQITTVPSMPLKPGAAGRPVAVVDEEGNEVPAGKEGFLVP
K
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggtgacggcacgtgtccgatcaccgatacctggtggcagaccgaaactggcatg
ttccagatcaccactgtgccgtcgatgccgctcaaaccaggtgccgctgggcgtccggtt
gctgttgtcgacgaggagggcaatgaggtccctgcgggcaaagagggcttcctcgtcccc
aagtga

DBGET integrated database retrieval system