KEGG   Propionibacterium acnes 6609: TIB1ST10_04695Help
Entry
TIB1ST10_04695    CDS       T02065                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pcn  Propionibacterium acnes 6609
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TIB1ST10_04695
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIB1ST10_04695
   00620 Pyruvate metabolism
    TIB1ST10_04695
   00640 Propanoate metabolism
    TIB1ST10_04695
  Energy metabolism
   00680 Methane metabolism
    TIB1ST10_04695
Enzymes [BR:pcn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     TIB1ST10_04695
Lipid biosynthesis proteins [BR:pcn01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   TIB1ST10_04695
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
991634..991819
Genome map
AA seq 61 aa AA seqDB search
MVGDGTCPITDTWWQTETGMFQITTVPSMPLKPGAAGRPVAVVDEEGNEVPAGKEGFLVP
K
NT seq 186 nt NT seq  +upstreamnt  +downstreamnt
gtggtcggtgacggcacgtgtccgatcaccgatacctggtggcagaccgaaactggcatg
ttccagatcaccactgtgccgtcgatgccgctcaaaccaggtgccgctgggcgtccggtt
gctgttgtcgacgaggagggcaatgaggtccctgcgggcaaagagggcttcctcgtcccc
aagtga

DBGET integrated database retrieval system