KEGG   Propionibacterium acnes 6609: TIB1ST10_05705Help
Entry
TIB1ST10_05705    CDS       T02065                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
pcn  Propionibacterium acnes 6609
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TIB1ST10_05705
Enzymes [BR:pcn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     TIB1ST10_05705
Exosome [BR:pcn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TIB1ST10_05705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1206209..1208143)
Genome map
AA seq 644 aa AA seqDB search
MAHDEFGGLTGWDLEGFHSGGDTEVWKRLGSHVVTIDDDERGPITGTRFAVWAPNAQAVE
VISDFNWWTGDRMRLIPGSGVWGTFVEGVDEGTLYKFRIQDQWGTWHEKVDPMARYSEQA
PQNASIVTETHYEWNDDEWIARREASRAHAEPMSVYEVHLGGWRHGLSYRELADQLVSYV
TWQGYTHVEFMPLAEHPFAPSWGYQVTGYFSPTSRYGSPDDLRYLIDKLHQAGIGVIMDW
VPGHFPKDDWALGRFDGTALYEHADPRQGEHKDWGTYIFNYGRNEVKSFLVSSALYWISE
FHADGLRVDAVASMLYLDYSREEGQWVPNKYGGRENLEAIDFLRYVNSHLYSRHPGILMI
AEESTSFPGVTKPVDDGGLGFGFKWNMGWMNDSLRYLELNPFHRQYHHGEMTFAMVYQYS
ENFILPISHDEVVHGKGSMITKIPGDDWQQFASLRAFYSYMWSFPGKQLVFMGQEFGQRH
EFDESVSLEWFVADLWGHGGLKRLFRDLNKIYKENPALWQLDSDPRGFEWINADDAGNNL
FSWLRRSDDGSTIACFTNFSPNPQTDYRIDLPMEGVWTEILNTDSLEYDGTGEFGNLGQI
VAAPLPAPDRLRAVATVCVPPMGSVWLRHNPSATAALPGDPGVQ
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atggctcacgatgagttcggaggactcaccggttgggacctcgaggggttccactctggt
ggggacacggaggtgtggaagaggctcgggtcccatgtcgtcactatcgacgacgatgag
cgcggtcccatcaccggcacccgcttcgctgtgtgggccccaaatgcccaggcggttgag
gtcatctctgacttcaactggtggactggtgaccgtatgcgcctcatcccggggtccgga
gtctggggcaccttcgtcgaaggagtcgacgagggaaccctctataagttccgcattcag
gaccagtggggtacctggcacgaaaaggttgacccaatggcccgttattcagagcaagct
cctcagaatgcttccatcgtcaccgaaacccactacgaatggaatgacgatgagtggatc
gcccgccgcgaggcctcccgcgctcacgccgaaccgatgagcgtctacgaggtccatttg
ggcggatggcgtcacgggctgagctaccgagagttggctgaccagctggtgagctatgtc
acttggcagggctatacccatgtggagttcatgccattggctgaacacccattcgctccc
tcctggggataccaggtcaccgggtacttctctcccaccagccgctacggatctcccgac
gacctgcgttacctcatcgataagctacatcaggccggcatcggagtcatcatggattgg
gttcccggccactttcccaaggacgactgggccctggggcgcttcgacggcaccgcgctt
tacgaacacgccgatccacgccagggcgaacacaaggactggggaacctacatcttcaac
tacggtcgtaacgaggtgaaatctttcctcgtctcaagcgcgctgtactggattagcgaa
ttccacgccgacggactgcgcgttgacgccgtcgcctcgatgctctacttggactactct
cgcgaagagggccagtgggtgcccaacaagtatggcggccgggagaacctagaggccatt
gacttcttgcgctatgtcaactctcacttgtattcgcgccaccccggcatcctcatgatc
gctgaggagtccactagtttccccggcgtcaccaagccggtcgacgacggtgggctgggg
ttcgggttcaagtggaatatgggctggatgaacgactcgctgcgatatctggagctcaac
ccattccaccgccagtaccaccatggcgagatgacctttgccatggtctaccaatactca
gagaacttcatcttgccgattagccacgacgaggtcgtgcatggcaagggatccatgatc
accaagattcccggtgacgactggcaacagttcgcgtccctgcgagccttctactcctac
atgtggtcttttcccggcaaacagctggtgttcatgggtcaggaatttggtcagcgccac
gagttcgacgagtcggtaagccttgagtggtttgtcgccgacctgtggggacacggcggt
ctcaaacgcctcttccgcgaccttaacaagatttacaaagaaaaccccgcattgtggcag
ctcgacagcgatccgcgcggattcgagtggatcaacgccgacgatgccggtaacaacctg
ttctcctggttacgccgttccgatgatggatcgacgattgcctgcttcacgaacttctct
cccaatccgcagaccgactatcgtatcgacctaccgatggaaggggtgtggaccgagatc
ctcaacaccgattccctggagtacgacggcaccggcgagttcggcaatctcggccaaatc
gtagccgccccactgccagctcccgatcgtctccgtgcggttgccacagtgtgcgttccg
ccgatgggatcggtgtggctacgtcacaatccgtcagcaaccgctgccctgcccggcgat
ccgggcgtgcaatga

DBGET integrated database retrieval system