KEGG   Propionibacterium acnes 6609: TIB1ST10_05810Help
Entry
TIB1ST10_05810    CDS       T02065                                 

Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pcn  Propionibacterium acnes 6609
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    TIB1ST10_05810
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    TIB1ST10_05810
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    TIB1ST10_05810
Enzymes [BR:pcn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     TIB1ST10_05810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
1228624..1229121
Genome map
AA seq 165 aa AA seqDB search
MTGSASVYLRAHQENRPALVGYFPVGHPSVPHSIDAMKALTTGTTGTGVDLVVIGMPYSD
PMMDGTVIQHVTTGALERGVRTRDTLLATEAVAGTGTPCVIMTYWNLVEHYGVDAYARDL
ASAGGSGLTTPDEAEDRGDSVTVGIDRMCAIVDDLAAGVRRAERQ
NT seq 498 nt NT seq  +upstreamnt  +downstreamnt
atgaccggtagcgccagtgtctacctcagggcccaccaagagaaccgcccggccctcgtc
ggttacttcccggtgggacacccgtcagttcctcactcgatcgatgctatgaaggcactg
actacgggcactactgggaccggtgtcgacctcgtcgtgatcggaatgccttactccgac
ccgatgatggacggcaccgtcattcagcacgtcactaccggggctctagagcgcggggta
cgcactcgcgacaccctattggccacagaggccgtggccgggaccggaactccgtgcgtg
attatgacctattggaaccttgtcgagcactacggtgtcgacgcttatgctcgcgatctg
gcatccgcgggtggctcagggctcaccacccccgatgaggctgaggatcggggggactca
gtgacggtaggaattgaccggatgtgcgccatcgtcgacgacctggcggccggagtacgg
cgggcggaacgccagtga

DBGET integrated database retrieval system