KEGG   Propionibacterium acnes 6609: TIB1ST10_05950Help
Entry
TIB1ST10_05950    CDS       T02065                                 

Definition
Holliday junction ATP-dependent DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
pcn  Propionibacterium acnes 6609
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:pcn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1259660..1260265
Genome map
AA seq 201 aa AA seqDB search
MISHFSGTVSAAGPTWVVLDNHGVGIKVLCPPATAASARINQDMSLHTSLVVREESLTLY
GFVEADDRDAFELVQTASGVGPKLAAAIMSVLDAAQLATAITEEDDATLCRVPGIGRKGA
AKMILELKDKVAALAPRGASASGATHVAAPWREQVAEGLVGLGWSTKDAEKAVDKVVALK
EADPAMSIGNLMRAALRSLAR
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
gtgatttcccatttttccggcacggtaagtgctgccggcccgacttgggtcgtccttgac
aatcatggggtcggtatcaaggtgctatgccctcctgccacagctgcgagtgctcgcatc
aaccaagatatgtccctgcacacttccctggttgtgagagaggagtccctgactctttac
gggttcgtcgaagctgatgatcgcgatgcttttgagctggtgcaaaccgcgtcgggagtc
ggtcccaaattagctgcagcgattatgagtgtccttgatgctgctcagctagccacggcg
attaccgaagaagatgacgcaactctatgccgcgttcccggtattggtcgcaaaggtgcg
gcgaaaatgatcctggagctcaaggacaaggtcgcagcccttgccccacgcggagcttcg
gcgagcggagcaacccatgtggccgcaccgtggcgggaacaggtggcggaagggctggtc
ggcttgggctggtcgactaaagacgcggagaaggccgtcgacaaggtggttgctctcaag
gaagccgatccagctatgagcatcggcaacctcatgcgagcggcgttgcgtagtttggcg
cggtga

DBGET integrated database retrieval system