KEGG   Propionibacterium acnes 6609: TIB1ST10_06110Help
Entry
TIB1ST10_06110    CDS       T02065                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
pcn  Propionibacterium acnes 6609
Pathway
pcn00230  Purine metabolism
pcn01100  Metabolic pathways
Module
pcn_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    TIB1ST10_06110
Enzymes [BR:pcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     TIB1ST10_06110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_18 MMR_HSR1 ABATE AAA_33 AAA_16
Motif
Other DBs
NCBI-ProteinID: AEH29515
Position
1296316..1296915
Genome map
AA seq 199 aa AA seqDB search
MSSVPVIPQARGLRHTGPVTVAVVSGPTAVGKGTVVGALLRSHPEIVVSRSVTTRPPRPT
ERDGIDYDFITPEQFDKLVDGEGLLEWATVHNSHRYGTPRGPVERAVADNRTVVLEIDLQ
GARQVRETYPQATQIFLAPPSWEELVHRLIGRGTETPEQQKQRLETAKVELANADEFDAV
VVNDTVDHAVAHLVELLSL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtccccgtcatccctcaggcccgagggcttcgtcacaccggcccggtcacc
gtggctgtcgtctccggacctaccgcagttggtaaagggaccgtggtaggggcgctgctg
cgtagccatccggagatcgtcgtttccaggtcggtgactacccgtccgccgcgccccact
gaacgcgatgggatcgattacgacttcatcacccctgagcagttcgacaagctcgttgac
ggcgagggtctccttgagtgggcaaccgtccataacagccaccggtacggcacaccgcgc
ggtcctgttgaacgggcagttgctgacaatcgcacggtcgtgctggaaatcgatctgcag
ggagctcgccaagttcgcgaaacctatcctcaggcgacccagatcttcctcgcgccaccc
tcatgggaggagctagtccaccgtctgatcggtcgcggcacggaaacaccagagcaacag
aagcagcgtctggagactgcaaaggttgagctggccaacgcggatgaatttgacgccgtt
gtcgtcaacgacaccgtagatcacgcagttgcgcatctggtagaattactaagtctgtga

DBGET integrated database retrieval system