KEGG   Propionibacterium acnes 6609: TIB1ST10_07765Help
Entry
TIB1ST10_07765    CDS       T02065                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
pcn  Propionibacterium acnes 6609
Pathway
pcn00900  Terpenoid backbone biosynthesis
pcn01100  Metabolic pathways
pcn01110  Biosynthesis of secondary metabolites
pcn01130  Biosynthesis of antibiotics
Module
pcn_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    TIB1ST10_07765
Enzymes [BR:pcn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     TIB1ST10_07765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXP_redisom_C DXPR_C Semialdhyde_dh NAD_binding_3 Secretin
Motif
Other DBs
NCBI-ProteinID: AEH29839
Position
complement(1632533..1633756)
Genome map
AA seq 407 aa AA seqDB search
MKKVIILGSTGSIGTQTLEVISSRRDQFEVAGISAGGSDVGSLAQQIIDFSIPVVAVARE
DAAEELQRALAVQAGSRGRIVPNPRILTGPDASTELAAMPADVVCNAITGAAGLRPTLAT
LAAGTTLALANKESLVIGGRLVTQAAASGQIVPVDSEHSAFAQCLRGGGRNEVRRLVLTA
SGGPFRGRDRASLADVSAAEAMKHPTWNMGRVITINSSTLVNKGLELLEAALLYDVDLDD
ITVVVHPQSIVHSMVEFWDGATIAQASPPDMRLPIALGLSWPDRLPDAAAGCDWSTATQW
TFEPLDNDTFGAVELARRAGHAAGTAPAVFNAANESCVDAFCAGSIGFLDITDTIAAVLD
EHLSGDENDTLGARHVGDEALTLDAVLAADAWGRRRAAEVCARGIRR
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaggtcatcattctcggctccaccggatcgatcggaacccaaactctagaggtc
atttcgtcacgtcgtgaccagtttgaggtcgctggcatatcggcaggtggctcggatgtt
ggctcactagctcagcagataatcgacttctctatccccgtcgtagctgtcgctcgtgag
gatgccgctgaggagcttcagcgggctttggccgtgcaggctggatcacggggccgtatc
gtgcccaatcctcggatccttactggcccggatgcgtcgacagagctggcagctatgccc
gctgatgttgtctgtaatgccattaccggcgcggctggtttgcgaccgaccctcgccacc
ttggccgcagggaccactttggccttagcgaacaaggagtcgttggtcattggtggcagg
ctcgttactcaggcggccgcctcaggacagattgtccccgtggattctgagcactccgcc
ttcgcccagtgcctacgagggggcgggcgcaacgaggtgcgtcgccttgttctgaccgca
tccggcggacctttccgcggtcgcgaccgtgcctccctggccgatgtcagcgctgccgag
gccatgaagcatcccacctggaatatgggccgggtcatcaccattaactcgtcgactctg
gtgaataagggtctggagctgctcgaggcggccctactttatgatgttgatctcgacgac
atcaccgtcgtcgtccatcctcaatccatcgtccactcgatggtggagttctgggatggc
gccactattgctcaggcttcgcctcccgacatgagattgccgattgccttgggactgtct
tggccggatcgccttcctgacgcagctgccggctgcgactggtcgacggctactcagtgg
accttcgaaccccttgacaacgacactttcggggccgtcgaactagcccgacgcgctggt
catgctgcgggtactgcgccggccgtgttcaatgccgctaacgagtcctgtgtcgacgcc
ttctgtgccggaagtatcggtttcctcgacattaccgacaccattgccgcggtccttgac
gagcacctatccggtgacgagaacgacacccttggtgctcgacatgtcggtgacgaggcc
ctcaccctcgatgccgtgttggccgccgacgcctggggtcgtcgtcgcgccgccgaggtg
tgtgcccgggggattcgccggtga

DBGET integrated database retrieval system