KEGG   Propionibacterium acnes 6609: TIB1ST10_08465Help
Entry
TIB1ST10_08465    CDS       T02065                                 

Definition
putative beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pcn  Propionibacterium acnes 6609
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:pcn00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:pcn00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1793215..1794249
Genome map
AA seq 344 aa AA seqDB search
MNPRAVEIAKKLSPEQRAGQCILVGVVPSDSPEYITNLIDTQCLAGIFLLGHWTSRSKLE
AMLSAVNHVSPQGIKPIVATDHEGGEIQNIRVPGVDHLPSQEALARMSPAKVQAVVTTGA
RQLAKLGVHMVFSPVAGVIDPRLGVRNKPIAKHHRGFGTDPHLCGQYSAAVVAGHRKAGI
ISTTKHFPGIGRITEDTDFKSAGITDDKTTRHDRYLESFRMAFDAGSEAVMIASAYYSKI
DPGTLGLFSSKIMTDMLRGDFGYQGLIVSDDLGSSVSVFSVDGGHRASKFVSAGGDLAIT
ADPLLAGPMIRALTSTATSASGKKRLVDAASHVINVKLAHSLTK
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgcgagctgtcgaaatcgccaagaaattgtctcccgagcaacgcgccggccaa
tgcattcttgtcggcgtagtgccatcagactcccccgaatacatcaccaacctcattgac
acccagtgcttagccggaatcttcctgctaggacactggacgagcaggtccaagcttgag
gccatgctcagcgctgttaatcacgtcagcccgcagggcatcaaacctattgtcgcaact
gaccacgaaggtggcgaaatccagaacatccgggtgccaggagtcgatcacctgccgagt
caggaagctctggcccggatgtccccggccaaggtgcaagcagtcgtaacgaccggtgct
cgtcaactcgccaaactcggcgtccatatggtcttctcccccgtggctggcgtcatcgac
cctcgccttggggtacgtaataagccaattgccaagcatcatcgtggtttcggaaccgat
ccgcacctctgcgggcaatactcggcagccgtcgttgcgggacaccgcaaagcggggatc
atttcgaccactaagcattttcctggcatcggacggatcacggaggatactgacttcaaa
tccgccgggattactgacgacaagaccacccgccacgaccgatatcttgagtctttccgg
atggcctttgacgctggatctgaagccgtcatgatcgcatccgcgtactactcaaagatc
gatcccggcaccctcgggttattttcatcaaagattatgacagatatgctgcgcggagac
ttcggttatcagggactcatcgtgtccgacgacctggggagttcagtctcagtattctca
gtcgatggtggtcatcgggcaagcaaattcgtctctgccggcggcgatctagctatcaca
gctgacccccttctggcaggccccatgattcgcgcgttgacgtcgaccgcgacgtccgcg
tccggtaagaagcgtcttgttgacgctgctagccatgtcatcaatgtcaaattggcgcat
tcattgacgaagtga

DBGET integrated database retrieval system