KEGG   Propionibacterium acnes 6609: TIB1ST10_08585Help
Entry
TIB1ST10_08585    CDS       T02065                                 

Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
pcn  Propionibacterium acnes 6609
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TIB1ST10_08585
   00670 One carbon pool by folate
    TIB1ST10_08585
Enzymes [BR:pcn01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     TIB1ST10_08585
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1825569..1826039)
Genome map
AA seq 156 aa AA seqDB search
MKVVAIAAVADNGVIGSGQDMLWHISEDFRRFKTVTMGHTLIFGRRTFEQIGKLPGRRHI
ICTRDPHWSHEGVDVATSPRQAVEMAREAGEEICFVAGGGQIYADAFELCDELDITEVHQ
NPNGAARFPAIDPEVWVEVRRESRDGFDFVGYRRRS
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgaaggtcgtcgctatcgccgccgttgctgataacggcgtcatcgggtcggggcaggat
atgctctggcacattagtgaggatttccgtcgttttaagactgtgacgatgggtcacaca
ttgatctttgggcgtcgtacctttgaacagatcggcaagcttcctgggcgtcgtcacatc
atctgcacccgcgacccgcactggtcccatgagggggtggacgtcgcaaccagcccgcgt
caggccgtcgagatggcgcgtgaggcaggcgaggagatctgttttgttgccggaggtgga
cagatctacgccgacgctttcgagttgtgcgacgagctcgacatcaccgaagtccaccag
aatccgaatggtgcggcgcgtttccccgccattgaccctgaggtgtgggtggaggttcgt
cgtgagtctcgtgacggcttcgatttcgtcgggtaccgacgccggtcatga

DBGET integrated database retrieval system