KEGG   Propionibacterium acnes 6609: TIB1ST10_10430Help
Entry
TIB1ST10_10430    CDS       T02065                                 

Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pcn  Propionibacterium acnes 6609
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:pcn00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2228089..2228811
Genome map
AA seq 240 aa AA seqDB search
MLAWQADDKPVIWFDAEHADESEAVIRGGIPLCAPWFGHGPNNDQDPQHGLARRTDFEVT
VADPFRVVGVAETASIGIRHEVVMTNTALEMTLTLTNHDQKPRVVEGMWHTYLRVADAAQ
ARVRGVRGASWHNFATGDKGSFDANELAVAPDTDTVIQGVGPALALLDPAWGRQIHVETT
GCPSAVVWNPRSSSTHADNPTAQAWRDFVCVETGACKDNAVIVAPHSDLTMSTRISVETL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgttggcctggcaagccgacgacaagcccgtcatctggttcgacgccgagcatgctgac
gagtccgaggccgtgatccggggaggaatcccgctgtgtgccccgtggtttggtcacggc
cccaacaatgatcaggacccccagcatggtctagcccgtcgcaccgacttcgaagtaacg
gtcgctgatcccttccgcgttgtcggggttgctgagaccgcgtccatcggaatccgtcac
gaggttgtcatgacgaacacagccttagaaatgacgcttactctcaccaaccatgatcag
aaaccacgcgtcgtcgaggggatgtggcacacctacctgcgcgtcgcagatgccgcacag
gcacgggtcaggggcgttcgcggcgccagctggcacaacttcgcgaccggcgacaagggg
tccttcgacgccaacgagcttgccgtagctcctgatactgacaccgtcatccagggagtc
gggcccgccctagccctcctcgatccagcgtggggacgccagatccacgtggagacaaca
gggtgtcccagtgccgtggtctggaatccacgctcctcgtcgacacatgccgataacccg
acagcccaggcatggcgcgatttcgtatgcgtcgagaccggggcctgtaaggacaatgcg
gtcattgttgccccacacagcgacctcaccatgtccacacggatcagcgtcgaaacgttg
tga

DBGET integrated database retrieval system