KEGG   Propionibacterium acnes 6609: TIB1ST10_10430Help
Entry
TIB1ST10_10430    CDS       T02065                                 

Definition
(GenBank) hypothetical protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
pcn  Propionibacterium acnes 6609
Pathway
pcn00010  Glycolysis / Gluconeogenesis
pcn01100  Metabolic pathways
pcn01110  Biosynthesis of secondary metabolites
pcn01120  Microbial metabolism in diverse environments
pcn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TIB1ST10_10430
Enzymes [BR:pcn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     TIB1ST10_10430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEH30356
Position
2228089..2228811
Genome map
AA seq 240 aa AA seqDB search
MLAWQADDKPVIWFDAEHADESEAVIRGGIPLCAPWFGHGPNNDQDPQHGLARRTDFEVT
VADPFRVVGVAETASIGIRHEVVMTNTALEMTLTLTNHDQKPRVVEGMWHTYLRVADAAQ
ARVRGVRGASWHNFATGDKGSFDANELAVAPDTDTVIQGVGPALALLDPAWGRQIHVETT
GCPSAVVWNPRSSSTHADNPTAQAWRDFVCVETGACKDNAVIVAPHSDLTMSTRISVETL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
gtgttggcctggcaagccgacgacaagcccgtcatctggttcgacgccgagcatgctgac
gagtccgaggccgtgatccggggaggaatcccgctgtgtgccccgtggtttggtcacggc
cccaacaatgatcaggacccccagcatggtctagcccgtcgcaccgacttcgaagtaacg
gtcgctgatcccttccgcgttgtcggggttgctgagaccgcgtccatcggaatccgtcac
gaggttgtcatgacgaacacagccttagaaatgacgcttactctcaccaaccatgatcag
aaaccacgcgtcgtcgaggggatgtggcacacctacctgcgcgtcgcagatgccgcacag
gcacgggtcaggggcgttcgcggcgccagctggcacaacttcgcgaccggcgacaagggg
tccttcgacgccaacgagcttgccgtagctcctgatactgacaccgtcatccagggagtc
gggcccgccctagccctcctcgatccagcgtggggacgccagatccacgtggagacaaca
gggtgtcccagtgccgtggtctggaatccacgctcctcgtcgacacatgccgataacccg
acagcccaggcatggcgcgatttcgtatgcgtcgagaccggggcctgtaaggacaatgcg
gtcattgttgccccacacagcgacctcaccatgtccacacggatcagcgtcgaaacgttg
tga

DBGET integrated database retrieval system