KEGG   Propionibacterium acnes 6609: TIB1ST10_10455Help
Entry
TIB1ST10_10455    CDS       T02065                                 

Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
pcn  Propionibacterium acnes 6609
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    TIB1ST10_10455
  Lipid metabolism
   00561 Glycerolipid metabolism
    TIB1ST10_10455
   00600 Sphingolipid metabolism
    TIB1ST10_10455
Enzymes [BR:pcn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     TIB1ST10_10455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2234778..2236895
Genome map
AA seq 705 aa AA seqDB search
MSASQEFTTMHDVTPVIQPFRLATAPDQPVGLAAGTLDGAVALPLVECLTLEHGRCFVDH
RLTQTTVGSGLRPVRREPLTSPWPGTRVIQHDRGSDLTVTVDLWHPTSATLHGRTTVHND
GKLPVHLTAVSIMCASLLSGAEFDDLDILIAPSAWMAEQRWTHHRLSDLLVDVGTELHGE
SPRDRFVLSSESGWSSGRWEPVGFITDPASGRAVGWQIEHNGGWTVELARRSSTLGLCLF
GPTDLQHHWMHQLNPGETFTTPAVTLVVSDNSWQGAAAELSTYRRVLRGNNGTAAPIVFN
DYMNTLMADPTAERLSTLIPAAARTGAEVYCIDAGWHSDDTDWWDDVGRWEPSPRRFPGG
LRHTLDLIVAYGMTPGLWIEPLAVGLRSPLVNDLPPEAFMRRAGVPIVEQNRVRLDMRNP
QARAHLDTVIDRMVSYGIGYLKIDDNFSVGSGPDEDADSPGDGLLGHCRAWAAWLADLPR
RHPGLVVENCASGGMTTDYALLARAAIQSTSDLQDSVRYPPIAANSPMTILPEQAANWAY
PQPDMDDEEIVFTVTTSLAGTFYLSGHVDRMNAHQMALVQSGAEVAKALRSDLTSQIPWW
PKGLAGWDDEWVVTGRRKKSSRDGVIIVWHRPSTESTVLDLPDLAGTHLEPLYPPASLVP
DPGIHIADSSGSPRLSCPSPKPTGRVFRVRDLHDCVTDVAEMEKK
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgtcggccagccaggagttcaccaccatgcacgatgtcacccctgtcatccagccgttt
cggctcgcgacggcccccgaccaaccggtcggcttggcagccgggactcttgacggcgcg
gtggcgcttcccctcgtcgaatgcctcaccctcgaacacggccgatgcttcgtcgaccat
cgcctcacccaaactacggtgggatccggtctgcgtcccgttcgccgcgaaccgctcacc
tcgccgtggcccggcacccgcgtcatccagcatgatcgaggatccgacctcaccgtcacc
gtcgatctgtggcatcccacctcagcgaccttgcacgggcgaacaaccgtacataatgac
ggcaagctcccagtccatctcactgccgtctctatcatgtgcgccagtctgctgtcagga
gccgaattcgatgacctcgatatactcatcgcacccagcgcatggatggccgaacaacgg
tggacccatcaccgcctgtccgatcttctggtggacgtcggcaccgaattgcatggagaa
tccccgcgcgaccgcttcgtcctatcctcagagtccggttggtcttcaggacgttgggaa
ccggtcggcttcattaccgacccggcctctggacgcgccgtcggctggcagatcgagcac
aacggtggctggactgtcgaattagcccggcgctcttcaaccctcggcctctgcctcttc
gggccgaccgaccttcagcaccactggatgcaccagctcaaccctggcgagactttcact
acccccgcggtgacgttagtggtatccgataacagctggcagggcgcggcagccgaacta
agcacctaccgccgtgtattgaggggcaacaatggcacagcagctccgatcgtcttcaac
gactacatgaacaccctcatggccgaccctacggccgagcgactctcgaccctcatcccg
gccgcagctcgcaccggagccgaggtgtactgcatcgacgccggatggcactccgacgac
acagactggtgggacgacgtcggccgctgggagccctcgccccgccgatttcccggcggg
ctgcgccacacccttgatctcatcgtcgcctacggcatgacgcccggcctgtggattgag
ccgctggcggttggtctgcgcagtcctctcgtcaatgatctacccccggaggctttcatg
cgccgcgcaggggttccgatcgtcgaacagaatcgggtgcgtctagatatgcgcaatccg
caagctcgcgctcatctagataccgtcatcgaccggatggtcagttacggcatcggctac
ctcaaaattgatgacaatttctctgtcggttctggccccgacgaggacgcggattctcct
ggggacggtttgctggggcactgccgcgcttgggccgcctggcttgccgacctccctcga
cgtcaccctggacttgtcgttgagaactgtgcatctgggggcatgaccaccgactacgcc
ctgttggcccgagcagccatccagtcgacatcagacctccaggattcggtgcgttacccg
cccatcgccgccaattcaccgatgacgattttgcccgaacaagccgccaattgggcttac
ccacagccagacatggacgacgaggaaatcgtctttaccgtcacgacctccttggccggc
accttttacttgtccggtcatgtcgaccgcatgaacgcccaccagatggctctcgtgcaa
tccggcgcagaggtagccaaggccttacggtcagatctgaccagccaaataccgtggtgg
ccgaaaggccttgccggctgggacgacgagtgggtcgtcaccgggcgtcgaaaaaagtcc
tctcgcgacggggtgatcattgtctggcaccgtcctagcaccgaatcgacggttctcgac
ttacctgacctggctgggacccacctcgaacccctttacccacctgcctccctggtcccc
gacccaggaattcacattgctgactcatcgggttcacctcggctgagttgtccgtctccc
aaaccaaccggccgggtcttccgcgtccgggaccttcacgattgcgtcaccgatgtcgca
gaaatggagaagaaatga

DBGET integrated database retrieval system