KEGG   Propionibacterium acnes 6609: TIB1ST10_11000Help
Entry
TIB1ST10_11000    CDS       T02065                                 

Definition
putative beta-N-acetylglucosaminidase precursor
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
pcn  Propionibacterium acnes 6609
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    TIB1ST10_11000
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    TIB1ST10_11000
Enzymes [BR:pcn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     TIB1ST10_11000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2343626..2345515)
Genome map
AA seq 629 aa AA seqDB search
MKRRTVMAAAAGAFAASALPLSRAAADDTRSQLASMTLDQKIGQVLWTHVFGASADDASM
ARKNQLAFGDDVRTPAQAVQKYHLGGVLYFNWSGNISTPTNPAAVAHLSNGLQEAARTSS
TAPLAIAVDQEGGIVARITSPATEFPGNMALGAVNDPRAARAQGAVLGRELAALGINVDF
APDVDVNTNPANPVIGVRSMGDDPVRVGVLGVEQIRGIQSRGVAATAKHFPGHGDTQIDS
HLGLPVVEYGRTTLERHLVPFRMAISAEVDMIMTAHIIVKTLDPTMPATLSKKVLTGLLR
EQMGYRGIITTDALDMEGAQLAVMTEDEKGTYTRLKAAADAEGNDPTAADEGHASAEFNA
FMKPIRGRVAVQAFEAGSDILLNPHDADAVVTAMRRAIADGRVSERRLDESVLRILSWKR
RRCITGRPVDLAAADREVRSGRKVADDIAARSVTMLVNDGTLPLKPSRVLVTGTRRGNPE
YLVEPLRLAGFTPILVPSTGQEPTTADVEKAVTVGVDAVIVVTHGLKRGDAQDAMVKALA
RTGNPVVEIMTGTPYDVAMTHCPHAALAVYSNRKVSMVAAVAMMAGRNPVGRLPVRVPDP
NGGTAFPRGFGLSYRATPGPYEGPGAKTA
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgacgcactgtcatggccgccgcggctggagcctttgcggcatcagcccttccg
ctgtcgcgagcggcagcggatgacacccggtctcagctcgcctccatgaccttggaccag
aagatcggtcaagtgctatggacccatgtcttcggtgccagcgctgacgacgcttcaatg
gcgaggaagaatcagctggcctttggcgatgacgtccgcactccggcccaggccgtgcag
aagtaccaccttggcggggtgctgtacttcaactggtccggtaacatctcgacgcccacg
aatccggccgccgtcgcccacctttccaacggcctgcaagaggcggcgaggacgtcgtcg
acggcgccgttggccatcgctgtcgatcaggagggcggtatcgtcgcgcggattacctcc
ccggccaccgaatttccagggaatatggcgctgggtgctgtcaatgacccgcgcgctgcg
cgtgcccaaggcgcggtgctcggtcgcgagctggctgccctgggcattaacgtggacttc
gccccggacgttgacgtcaacactaacccagccaatcccgtaatcggggtgaggtccatg
ggggacgatccggtgcgcgtcggggtactcggcgtcgagcagattcgcggcattcaatcc
agaggggttgcggccaccgccaagcatttcccaggtcatggtgatacccagatcgactcc
catcttggtcttccggtcgtggagtacggtcgcactaccctggagcgtcacctggtgccc
ttccgcatggcgatcagcgcggaagtggacatgatcatgacagcccacatcatcgttaag
accttggacccgacgatgccggccaccctgtcgaagaaagtgcttactggcctgctgcgc
gaacagatggggtatcgcggcatcatcaccaccgacgccctggacatggagggcgcccag
cttgcggtcatgaccgaggacgagaagggcacgtataccaggctcaaggctgctgccgac
gccgagggcaatgaccccacggcggccgatgaggggcatgcgagtgccgagttcaacgcc
tttatgaaaccgatccgggggcgtgttgcggtgcaggctttcgaagccggatccgacatt
ttgctgaacccccatgacgctgatgccgtcgtcacagcgatgcggagggctatcgcggac
ggtcgggttagcgagcggcgtctcgacgaatcggtgctgcgcatcctctcttggaagcgg
cgtcgctgcattacgggcaggccggttgacctcgcggcggccgatcgtgaggtacgatct
ggccgcaaggttgctgacgacatcgctgccaggtcggtgacgatgctggtcaatgacggc
actctgccgctcaagccgtcacgggtgctcgtcaccggaacacgtcggggtaatccggag
tacctcgtcgagccgttgcgcttggccggattcaccccgattcttgttccgtcaaccgga
caggaaccgacgacagccgatgtcgagaaagcggtgactgtcggtgttgatgccgtcatc
gtggtcacgcacgggttgaaacgtggagatgcccaggacgccatggttaaggctctggcg
cggaccgggaatccggtcgtggagattatgacagggaccccgtacgacgtggcgatgact
cattgcccgcatgccgcactagctgtctactccaaccgcaaggtgagcatggttgcggct
gtcgcgatgatggctggacgaaacccggtggggcgacttccggtacgggtgcccgacccg
aacggaggcacagcttttccgcgcggtttcgggctcagctaccgcgcgacgcccggaccc
tatgagggcccgggcgcgaagactgcttga

DBGET integrated database retrieval system