KEGG   Propionibacterium acnes 6609: TIB1ST10_11735Help
Entry
TIB1ST10_11735    CDS       T02065                                 

Definition
glycerol kinase 2
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
pcn  Propionibacterium acnes 6609
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcn00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    TIB1ST10_11735
Enzymes [BR:pcn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     TIB1ST10_11735
Exosome [BR:pcn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TIB1ST10_11735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2502602..2504125)
Genome map
AA seq 507 aa AA seqDB search
MSDEKFVLAIDEGTTSARAIIFNHAGQIMAVGQQEFEQIFPRAGWVEHDPIEIWEAVRDV
VGLALTKANINRHQLAAAGITNQRETAVVWDKNTGEPVYNAIVWQDTRTQKICNELAGDK
GADRYKEICGLGLSTYFSGPKVKWILDNVEGARARAEAGDLLFGNMDTWVLWNLTGGTNG
GVHITDPTNASRTMLMDVRKLQWDDSMCEVMGIPKSMLPEIKSSSEIYGYGRKNGLLIDT
PISGILGDQQAATFGQACFQKGMAKNTYGTGCFMLMNTGEEAIFSENGLLTTVCYKIGDQ
PTVYALEGSIAVAGSLVQWLRDNLKMFETAPQIEALANTVEDNGGAYFVPAFSGLFAPYW
RPDARGALVGLTRYVNRGHIARAVLESTAFQTREVLEAMNADSGVPLTELRVDGGMTANE
TLMQFQADQVNVPVVRPVVAETTALGAAYAAGIAVGFWEGENDVTDNWAEDKRWEPKMDK
NERERLFRNWKKAVTKTFDWVDDDVKE
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatgagaagtttgtactcgccattgacgagggcactacttccgcccgtgccatc
atctttaaccacgccggccagatcatggccgttggccagcaggagttcgagcagatcttc
ccgcgtgctggatgggttgagcatgacccgatcgagatctgggaggccgttcgcgacgtc
gttgggctcgccctgaccaaggccaacatcaaccgccaccagctggctgctgctggtatc
accaaccagcgcgagaccgcagtggtgtgggacaagaacaccggtgagccggtttataac
gccatcgtgtggcaggacacgcgcactcaaaagatctgtaacgaactagctggtgacaag
ggcgccgaccgctacaaggagatctgtggtctgggcctgtcgacctatttctctggcccg
aaggtcaaatggattctcgacaacgttgagggagcccgtgcgagggccgaggccggcgat
ctgctcttcggtaacatggacacttgggtgctgtggaacctgactggcggtactaacggt
ggcgtgcacatcaccgatccgaccaacgcgtcccgaaccatgctcatggacgtccgaaag
ctgcagtgggacgactcgatgtgcgaggtcatggggattccgaagtccatgcttcctgag
atcaagtcctcctccgagatctacggctatggtcgcaagaacggcctgctgatcgatacc
ccgatctccggcattcttggcgatcagcaggccgccacttttggccaggcttgcttccaa
aagggcatggcgaagaacacgtacggcaccggctgcttcatgctcatgaacacaggtgag
gaggccatcttctccgagaacggtctgctgaccaccgtctgctacaagatcggtgaccag
cccaccgtctatgccctggaaggttcgattgccgtcgctggatcgctggtacagtggctg
cgcgacaacctcaagatgttcgagaccgccccgcaaatcgaagctctcgctaacaccgtc
gaggacaatggtggcgcctactttgtgccggccttctctggcctgttcgcgccgtactgg
cgtccagacgcccgtggtgccctcgtgggcttgacccgctacgtcaaccgtggccacatt
gcccgcgccgtgctcgagtcaaccgccttccagactcgcgaggttcttgaggctatgaac
gccgactccggtgtgccgctgacggagctgcgcgtcgacggtggcatgaccgccaacgaa
accctcatgcagttccaggccgaccaggtcaatgtgccggtggttcgccccgtggtcgcc
gaaaccaccgctctgggcgccgcctacgccgctggcatcgctgtcggtttctgggaaggc
gagaatgacgtcaccgacaactgggccgaggacaagcgctgggaacccaagatggacaag
aatgagcgcgaacgtctgttccgcaactggaagaaggctgtcactaagaccttcgactgg
gtggacgacgacgtcaaggagtga

DBGET integrated database retrieval system