KEGG   Psychrobacter cryohalolentis: Pcryo_0018Help
Entry
Pcryo_0018        CDS       T00350                                 

Definition
zinc-binding alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Pcryo_0018
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcryo_0018
  Lipid metabolism
   00071 Fatty acid degradation
    Pcryo_0018
  Amino acid metabolism
   00350 Tyrosine metabolism
    Pcryo_0018
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Pcryo_0018
   00626 Naphthalene degradation
    Pcryo_0018
Enzymes [BR:pcr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Pcryo_0018
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(23219..24223)
Genome map
AA seq 334 aa AA seqDB search
MSKQTTFKALVVEEHADGTFSKSIQQRSVSDLPENDLLIEVHYSSLNFKDAMSASGNKRI
TKNYPHTPGIDAAGVVVSDKSGTFTAGQEVVVFGYDLGMDTDGGLSQMISIPADWAVECP
SSLTLKEAMIYGTGGLTAALSIQKLEKMGAKPEDGPVAVTGATGGVGSISIAILSQLGYE
IIAFSGKPEQSDYLKELGASEVRHRDTINEVGDKPAGRELWANAIDTIGGDYLANLLKQT
KAGGAVTSCGLASGAEFSMSVIPFITRAVSLLGIDSVYIPLADKKAIWERVATDMKLPNL
ESYGEEITLEQTPEYLDRFMASKTVGRYVVNVKG
NT seq 1005 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaacaaacaacgtttaaagctttggtcgtcgaagaacatgctgatggcactttt
agtaaaagtattcaacagcgcagcgtcagtgacttacctgaaaacgatttattaatcgaa
gtacattactcatcactaaacttcaaagatgccatgtcggcatcaggtaataaaagaatc
accaaaaactatccgcatacccctggtattgatgcggcaggcgtggtggtcagtgataag
tctggcacgtttaccgcaggccaagaagtcgtggtctttggttatgatttgggcatggat
accgatggtggcttaagtcaaatgatctctatccctgctgattgggcagtcgaatgccca
tcttctttgacattaaaagaagcgatgatatatggtactggcggcttaaccgctgcatta
agtatccaaaagctagaaaaaatgggcgcaaaacctgaagatggtccagtcgccgtcact
ggcgcaacgggcggtgtcggtagtatcagcatcgcgatattaagtcagctaggctatgag
attattgccttctctggtaagcctgagcaaagtgactatttaaaagagcttggtgcgagt
gaagtccgtcatcgcgataccattaacgaggtcggagataaacctgccggtcgtgaactg
tgggcaaatgctattgataccattggcggcgattatttggcgaacctacttaagcaaacc
aaagctggcggcgcagtcacctcttgtggtttggcgagcggtgctgagttttcaatgtca
gtgataccttttatcacccgtgcggtgtcgctattgggtatcgactcggtctatattcca
ctagctgataaaaaggctatctgggagcgcgttgctactgatatgaagttgcctaatctt
gagagttatggtgaagagattacgcttgagcaaacgccagaatacttggatcgctttatg
gcgagtaaaacggtcgggcgttatgtggtgaatgttaagggttag

DBGET integrated database retrieval system