KEGG   Psychrobacter cryohalolentis: Pcryo_0070Help
Entry
Pcryo_0070        CDS       T00350                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pcryo_0070
   01230 Biosynthesis of amino acids
    Pcryo_0070
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcryo_0070
   00051 Fructose and mannose metabolism
    Pcryo_0070
   00562 Inositol phosphate metabolism
    Pcryo_0070
Enzymes [BR:pcr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pcryo_0070
Exosome [BR:pcr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pcryo_0070
  Exosomal proteins of bladder cancer cells
   Pcryo_0070
  Exosomal proteins of melanoma cells
   Pcryo_0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
80047..80856
Genome map
AA seq 269 aa AA seqDB search
MQAWVIGNWKQNPATSHDVNALLDDLCAAISTTKQMSHDNSARCQIMVAPSFIHLAAVNG
RLKDTSILCAAQDVSGHSASVGAYTGDCSAQQIVDAGATWTILGHSERRQYHQESNDTLL
QKMIHALSQDLGVVFCIGESQAQYDTKQTLEVIDNQLAVIKEFITQQPELIKALPTRLII
AYEPVWAIGTGKVPTVAEVSATHKHIKQILAGFADSLSNMTVLYGGSVNADNANSFAADP
MIDGALVGGASLKADSFLTIATAFSQASI
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcttgggtaattggaaattggaagcagaatccagcaacgagccatgacgtaaac
gcactactggacgatttatgcgctgctattagtacaaccaagcaaatgagccacgataac
tccgcgcgttgtcaaataatggtagcaccaagcttcatacatttagcagcagtgaatggt
cgcctaaaagacacctcaatactgtgcgcagctcaagacgttagtggacacagtgccagt
gttggtgcttatacaggtgactgttcagcgcagcagatagtcgatgctggagcgacttgg
acaattcttggtcactcagagcgccgtcagtatcatcaagaatctaacgatactctattg
caaaaaatgattcatgcgttgtcacaagatttaggcgtggtattttgcattggtgaaagc
caagcacaatatgataccaagcaaacgcttgaagtcatcgataatcagttagcagttatc
aaagaattcattacacagcagccagaacttattaaggcattaccgactcgtctcattatt
gcttatgagccagtatgggcaataggtacaggtaaagtgccaacggtagcagaagtcagc
gccactcataagcatatcaagcaaatattggcaggatttgccgactcattgtctaatatg
acggttttgtatggcggtagtgtcaatgctgataatgctaatagctttgctgctgatcct
atgattgatggcgctttagttggcggtgcttcattgaaagctgacagctttctgacgatt
gccactgcttttagccaagccagtatctag

DBGET integrated database retrieval system