KEGG   Psychrobacter cryohalolentis: Pcryo_0070Help
Entry
Pcryo_0070        CDS       T00350                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pcryo_0070
   01230 Biosynthesis of amino acids
    Pcryo_0070
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcryo_0070
   00051 Fructose and mannose metabolism
    Pcryo_0070
   00562 Inositol phosphate metabolism
    Pcryo_0070
Enzymes [BR:pcr01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Pcryo_0070
Exosome [BR:pcr04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Pcryo_0070
  Exosomal proteins of bladder cancer cells
   Pcryo_0070
  Exosomal proteins of melanoma cells
   Pcryo_0070
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
80047..80856
Genome map
AA seq 269 aa AA seqDB search
MQAWVIGNWKQNPATSHDVNALLDDLCAAISTTKQMSHDNSARCQIMVAPSFIHLAAVNG
RLKDTSILCAAQDVSGHSASVGAYTGDCSAQQIVDAGATWTILGHSERRQYHQESNDTLL
QKMIHALSQDLGVVFCIGESQAQYDTKQTLEVIDNQLAVIKEFITQQPELIKALPTRLII
AYEPVWAIGTGKVPTVAEVSATHKHIKQILAGFADSLSNMTVLYGGSVNADNANSFAADP
MIDGALVGGASLKADSFLTIATAFSQASI
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcttgggtaattggaaattggaagcagaatccagcaacgagccatgacgtaaac
gcactactggacgatttatgcgctgctattagtacaaccaagcaaatgagccacgataac
tccgcgcgttgtcaaataatggtagcaccaagcttcatacatttagcagcagtgaatggt
cgcctaaaagacacctcaatactgtgcgcagctcaagacgttagtggacacagtgccagt
gttggtgcttatacaggtgactgttcagcgcagcagatagtcgatgctggagcgacttgg
acaattcttggtcactcagagcgccgtcagtatcatcaagaatctaacgatactctattg
caaaaaatgattcatgcgttgtcacaagatttaggcgtggtattttgcattggtgaaagc
caagcacaatatgataccaagcaaacgcttgaagtcatcgataatcagttagcagttatc
aaagaattcattacacagcagccagaacttattaaggcattaccgactcgtctcattatt
gcttatgagccagtatgggcaataggtacaggtaaagtgccaacggtagcagaagtcagc
gccactcataagcatatcaagcaaatattggcaggatttgccgactcattgtctaatatg
acggttttgtatggcggtagtgtcaatgctgataatgctaatagctttgctgctgatcct
atgattgatggcgctttagttggcggtgcttcattgaaagctgacagctttctgacgatt
gccactgcttttagccaagccagtatctag

DBGET integrated database retrieval system