KEGG   Psychrobacter cryohalolentis: Pcryo_0099Help
Entry
Pcryo_0099        CDS       T00350                                 

Definition
putative uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:pcr00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
114789..115766
Genome map
AA seq 325 aa AA seqDB search
MSWSSSKSTDSNQPINTPLLLPQLVINTRPVERAAPLTRHLQAAGMSVVDMPMLTLQPRL
TTDSDMILMRQWLAGEYQALVIVSPTAAASGLAIWQLLEREHQANGATDKAVEAIEGSSN
ISVAPSHLIAVGEATAAVLNEAKLSNASYQVLQPVIANNEGMLAMPEIDSLQAGDKLLVW
RGLGGRRLLVDTLQARGVHIDSIAWYERKMPIDAMMQYQQWLQDFNNRNATVGITASQQG
KPIVIVSSGTAFEHWESIVQAAKTFDVAAEHQVMSVNAPLKLSDFSYVVLGERLANMVAE
QNLSYWRVEDLAPETILTAIKTTSL
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtcttggtcatcatctaagtccacggattcaaatcaaccaattaatacgccattattg
ctgccgcaacttgtcatcaatacgcgcccagtcgagcgtgccgccccactgacgcgacat
ttacaagcggcaggtatgtcggttgttgatatgccgatgttgacactgcaaccgcgtttg
accactgatagtgatatgatactgatgcgccagtggctagcaggcgagtatcaagcattg
gtcatcgttagcccgacagcggcagcctcaggtttggctatttggcagttgcttgagcgt
gagcaccaagctaatggcgcgactgataaagcagtagaggctatagaaggtagctctaat
atttcagtagcgccaagccatctgattgcggttggtgaagcgactgctgctgtgttaaat
gaggcaaagttatcaaacgccagttatcaagtactgcagcctgttattgctaataatgaa
ggtatgctggcgatgcctgagattgatagcctgcaggcgggggataagctactcgtgtgg
cgaggtcttggtggacgacgattattggttgatactttgcaagcgcgcggtgtgcatatc
gatagcattgcttggtacgagcgcaaaatgcctattgatgccatgatgcagtatcagcaa
tggctacaagatttcaataatcgaaatgcgaccgttggcataaccgcgtcacagcaagga
aaacccattgtcattgtaagtagtggtaccgcatttgagcattgggaaagtatcgttcag
gctgccaaaacattcgatgtagcagcagaacaccaagtaatgtcagtcaatgcgccactt
aaactatcagacttttcttatgtggtattgggtgagcgcttagccaatatggttgctgag
caaaatttaagttattggcgcgtagaggatttggcaccagaaaccattctcactgctatt
aagacaaccagtttataa

DBGET integrated database retrieval system