KEGG   Psychrobacter cryohalolentis: Pcryo_0108Help
Entry
Pcryo_0108        CDS       T00350                                 

Definition
succinate dehydrogenase hydrophobic membrane anchor subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pcryo_0108
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pcryo_0108
   00650 Butanoate metabolism
    Pcryo_0108
  Energy metabolism
   00190 Oxidative phosphorylation
    Pcryo_0108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
124897..125301
Genome map
AA seq 134 aa AA seqDB search
MKNDSGIKSATSLTGSGSRDWIVQRISAVVLAVYSVVLLGFFLTHGDVSYTEWSNFMTSL
PMRLFSLVAVLALAGHAWIGMWTVFTDYITTGKLGASAAGLRLVLQTLMIIAVFVFLFWG
IMIFWGNGFGVAAV
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgattcaggaataaaaagcgcaaccagtctaaccggctcaggctcccgtgat
tggattgtccaacgtatcagtgcggtggtcttagcagtttatagtgtggtgctattgggc
ttctttttaacccatggcgatgtgagctacacggaatggtctaattttatgaccagctta
ccgatgcgtctatttagcttagtagcagttctagcccttgcgggtcatgcatggattggc
atgtggaccgtattcacagactatatcactaccggtaaattgggcgcgagcgcagctggc
ctacgcttggtcttacagacattaatgattattgccgtttttgtatttttattctggggc
atcatgattttttggggtaacggcttcggtgtcgctgctgtttaa

DBGET integrated database retrieval system