KEGG   Psychrobacter cryohalolentis: Pcryo_0108Help
Entry
Pcryo_0108        CDS       T00350                                 

Definition
(GenBank) succinate dehydrogenase subunit D
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr00020  Citrate cycle (TCA cycle)
pcr00190  Oxidative phosphorylation
pcr00650  Butanoate metabolism
pcr01100  Metabolic pathways
pcr01110  Biosynthesis of secondary metabolites
pcr01120  Microbial metabolism in diverse environments
pcr01130  Biosynthesis of antibiotics
pcr01200  Carbon metabolism
Module
pcr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
pcr_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pcryo_0108
   00650 Butanoate metabolism
    Pcryo_0108
  Energy metabolism
   00190 Oxidative phosphorylation
    Pcryo_0108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS Fumarate_red_C
Motif
Other DBs
NCBI-ProteinID: ABE73892
JGI: Pcryo0108
UniProt: Q1QEL1
Position
124897..125301
Genome map
AA seq 134 aa AA seqDB search
MKNDSGIKSATSLTGSGSRDWIVQRISAVVLAVYSVVLLGFFLTHGDVSYTEWSNFMTSL
PMRLFSLVAVLALAGHAWIGMWTVFTDYITTGKLGASAAGLRLVLQTLMIIAVFVFLFWG
IMIFWGNGFGVAAV
NT seq 405 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaacgattcaggaataaaaagcgcaaccagtctaaccggctcaggctcccgtgat
tggattgtccaacgtatcagtgcggtggtcttagcagtttatagtgtggtgctattgggc
ttctttttaacccatggcgatgtgagctacacggaatggtctaattttatgaccagctta
ccgatgcgtctatttagcttagtagcagttctagcccttgcgggtcatgcatggattggc
atgtggaccgtattcacagactatatcactaccggtaaattgggcgcgagcgcagctggc
ctacgcttggtcttacagacattaatgattattgccgtttttgtatttttattctggggc
atcatgattttttggggtaacggcttcggtgtcgctgctgtttaa

DBGET integrated database retrieval system