KEGG   Psychrobacter cryohalolentis: Pcryo_0112Help
Entry
Pcryo_0112        CDS       T00350                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr00020  Citrate cycle (TCA cycle)
pcr00310  Lysine degradation
pcr01100  Metabolic pathways
pcr01110  Biosynthesis of secondary metabolites
pcr01120  Microbial metabolism in diverse environments
pcr01130  Biosynthesis of antibiotics
pcr01200  Carbon metabolism
Module
pcr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pcryo_0112
  Amino acid metabolism
   00310 Lysine degradation
    Pcryo_0112
Enzymes [BR:pcr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Pcryo_0112
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 GCV_H RnfC_N DUF1390
Motif
Other DBs
NCBI-ProteinID: ABE73896
JGI: Pcryo0112
UniProt: Q1QEK7
Position
132092..133324
Genome map
AA seq 410 aa AA seqDB search
MAEIKAPVFPESVADGTIVEWHVTEGQQVNRDDLLAEIETDKVVLEVVAPDNGVVTRIVK
QVDDTVLSDELIAEFEAGASASAEAAPAVDPDQPAAPVQPKQATDGGEPVQASAESDHKD
QSPAVRKAAKESGVDPKNVEGSGRGGRVTKTDMSNPTLKADSSITSDSGRPVAEAVGERT
EKRVPMTRLRKTIANRLLAASQETAMLTTFNEVNMKPLMDMRTKYKDQFEKRHGTRLGFM
SLFVKAATEALKRYPAVNASLDGDDIVYHGYYDIGVAVSSNRGLVVPVLRDTDRMSMADV
EAKIREFGGKAQEGKLGLEDMVGGTFTISNGGVFGSLMSTPILNPPQTAILGMHAINDRP
MAVNGEVKILPMMYLALSYDHRMIDGKEAVQFLVTLKELVEDPTMLLLDL
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaattaaagcccccgtttttccagaatcggttgccgatggtacaatcgttgaa
tggcatgtcactgaaggtcagcaagtaaaccgtgatgacctattagctgaaatcgaaact
gataaagttgtattagaagtggtcgcgcctgataacggtgttgtaacccgaatcgttaag
caagtagatgataccgtattgtctgatgagctgattgccgaatttgaagctggtgctagc
gccagtgctgaagctgctcctgccgttgatccagatcaaccagctgcgccagtacaacct
aagcaagcaacagatggcggcgagccagtacaagcgtctgctgaatctgatcataaagat
caaagccctgcggttcgtaaagcagccaaagagtctggcgtagatcctaaaaacgtcgaa
ggtagtggtcgcggcggtcgtgtgaccaaaactgacatgtcaaacccaacgttaaaagcg
gatagctcaatcacttctgatagtggtcgtcctgttgctgaagcagttggcgagcgtact
gaaaaacgcgtaccaatgacacgtctacgtaaaacaatcgcgaatcgtctactagctgct
tctcaagaaacggcaatgttaacgacgtttaacgaagtcaacatgaaaccgttgatggac
atgcgtactaagtataaagatcagttcgaaaagcgtcatggtacacgtttaggctttatg
tcgttattcgtaaaagcggcgactgaagccctaaaacgttatccagctgtgaacgcgtca
ttagacggtgatgatatcgtttatcatggttactatgacatcggtgttgccgtatcttct
aaccgtggtctagtcgtaccagtactgcgtgatactgatcgcatgagcatggcagatgtt
gaagccaagattcgtgagtttggtggtaaagcacaagaaggtaaacttggtctagaagac
atggttggcggtacatttaccatctcaaacggtggtgtatttggttcactgatgtcaaca
cctatcttgaacccaccacaaactgctatcttgggtatgcatgctatcaatgaccgtcct
atggcagttaatggtgaagttaaaatcttgccaatgatgtatcttgcactgtcttatgac
catcgtatgattgatggtaaagaagcggtacaattcttagtaacactgaaagaattggtt
gaagaccctactatgctacttttagatctttaa

DBGET integrated database retrieval system