KEGG   Psychrobacter cryohalolentis: Pcryo_0114Help
Entry
Pcryo_0114        CDS       T00350                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr00020  Citrate cycle (TCA cycle)
pcr00640  Propanoate metabolism
pcr00660  C5-Branched dibasic acid metabolism
pcr01100  Metabolic pathways
pcr01110  Biosynthesis of secondary metabolites
pcr01120  Microbial metabolism in diverse environments
pcr01130  Biosynthesis of antibiotics
pcr01200  Carbon metabolism
Module
pcr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
pcr_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Pcryo_0114
   00640 Propanoate metabolism
    Pcryo_0114
   00660 C5-Branched dibasic acid metabolism
    Pcryo_0114
Enzymes [BR:pcr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Pcryo_0114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABE73898
JGI: Pcryo0114
UniProt: Q1QEK5
Position
135235..136401
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKELLKSYGLPIQEGIIAYSGDEAAAAFDKTPTDIAVIKAQVHAGGRGKAGGV
KLVKTREEAKQVTDELIGKNLVTYQTDAAGQPVNFVLVAEDMYPVQTELYLGAVVDRSSR
RVTFMASTEGGVEIEKVAEETPEKIFKVNIDPLVGLLPFQAREVAFKLGLEGKQINQFVK
LMSGAYQAFVENDIDLLEINPLAVRENGEIVCVDGKIGIDSNALYRLPKIAALQDKSQEN
ERELKAAEFDLNYVALEGNIGCMVNGAGLAMATMDIIKLYGGKPANFLDVGGGATKDRVV
EAFKIILEDSSVEGVLINIFGGIVRCDMIAEAIIAAIKEVDVKVPVVVRLEGNNAELGAQ
ILEESGLKLISAQGLSDAAQKIVDAVKA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttacatgagtatcaagcaaaagagctattgaaaagctacggcttgccaattcaa
gaaggcatcattgcttacagtggcgacgaagcagcggcagcttttgacaaaaccccaact
gatatcgcagtcatcaaagcgcaggttcatgctggtggtcgcggtaaagcgggcggcgtg
aaactggttaagactcgtgaagaagcgaagcaagtgactgatgagcttatcggtaaaaac
cttgtaacgtatcaaaccgatgccgctggtcaaccagtgaatttcgttttggttgcagaa
gatatgtatccagtgcaaaccgagctatatcttggcgctgttgttgaccgctcttcacgt
cgcgtgacgtttatggcatcaacggaaggcggtgttgagattgagaaagttgcagaagaa
acgccagagaaaatctttaaagtaaatattgatccattggttggtttattgccattccaa
gcgcgtgaagtcgcgtttaaattgggtcttgaaggcaagcaaatcaatcaattcgttaaa
ttgatgtctggtgcttatcaagcattcgttgaaaacgacattgatttacttgaaatcaac
ccattagcggttcgcgaaaatggcgagatcgtttgtgttgatggcaaaattggtattgac
tcaaacgctttatatcgtttgcctaagattgctgcgctacaagacaaatcacaagaaaat
gagcgtgagcttaaagcggctgagtttgatctaaactatgttgccctagaaggcaatatc
ggttgtatggtaaacggtgctggtcttgcaatggctacgatggacatcatcaaattgtac
ggcggcaagcctgctaacttcttggacgttggcggcggtgcaactaaagatcgcgttgtt
gaagccttcaagatcattcttgaagacagcagcgttgaaggtgttctgatcaacatcttc
ggtggtatcgtacgttgtgacatgattgcagaagctattatcgctgcgatcaaagaagtt
gacgtcaaagtaccagttgttgtccgtttagagggtaacaatgctgagcttggcgcacaa
attctagaagaatctggtctgaaattgatctcagctcaaggtttatcagacgccgctcaa
aaaattgttgacgctgttaaagcttaa

DBGET integrated database retrieval system