KEGG   Psychrobacter cryohalolentis: Pcryo_0117Help
Entry
Pcryo_0117        CDS       T00350                                 

Definition
nucleotidyl transferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Pcryo_0117
   00052 Galactose metabolism
    Pcryo_0117
   00500 Starch and sucrose metabolism
    Pcryo_0117
   00520 Amino sugar and nucleotide sugar metabolism
    Pcryo_0117
Enzymes [BR:pcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Pcryo_0117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
138583..139467
Genome map
AA seq 294 aa AA seqDB search
MKKITHAVIPVAGFGTRMLPLSKSVPKELLPLGKRPAIHYVVAEAIAAGIKHIVLVGHAQ
KSAIENYFDLNAELDNQLRVKGKNELADSLNWLPDDVTISMIRQGQPLGLGHAVLAARPI
IGKHDFAVLLPDVVLDPFNGDMSADNLAFMIDAFSVDNHSQILVDKVTDEDVHKYGIAQL
SEALMDEGDIDDKTDKNVSFKVAGFVEKPNLSDAPSRLAVVGRYVFSHHIFDYLANTQAS
VGGEIQLTDAIDALISEYGVNVTTMRGNSYDAGDMRSYMQAFIYFAQQQLADEE
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattactcacgcggtgatacccgttgcaggctttggtactcgtatgttgcca
ttgtctaaatccgtacctaaagagctattgccgcttggtaaacgtcctgccatccattat
gtggtggcagaagctattgctgccggtattaagcacattgtcttggttggtcatgcacaa
aaaagtgctattgaaaattactttgatctcaatgccgagcttgacaatcaattgcgtgtt
aaaggtaagaacgagctagcagacagcttaaactggctaccagatgatgtaactatatcg
atgatacgtcagggtcagccattgggtttaggtcatgcggtgcttgccgcacgcccaatc
attggtaagcatgattttgcagtactgctgccagatgtggtgcttgatccttttaatggt
gatatgtctgctgacaatttggcgtttatgattgacgctttttctgtagataaccattcg
caaatattggtcgataaagtaaccgatgaagacgtacataaatacggtatcgctcaatta
agtgaagcgcttatggatgagggcgatatagatgataaaacagataagaatgtcagtttt
aaagtggcaggttttgtagaaaagccaaatctctctgatgcgccatccagactcgctgtg
gttggtcgttatgtctttagtcatcatatttttgattatctggcgaatacccaagcctca
gttggcggagaaattcaactgacggatgctattgatgcgcttatcagtgagtatggtgtc
aatgtcacgaccatgcgtggtaacagttatgatgctggcgatatgcgctcttatatgcaa
gcctttatatatttcgctcagcagcaactagccgatgaagagtag

DBGET integrated database retrieval system