KEGG   Psychrobacter cryohalolentis: Pcryo_0124Help
Entry
Pcryo_0124        CDS       T00350                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Pcryo_0124
Enzymes [BR:pcr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Pcryo_0124
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
148131..148697
Genome map
AA seq 188 aa AA seqDB search
MNTRFNDTDFDSKSIAICSWVTCYVGLGSNLVNELGAPVEHLQHAFEMMQEQEKIRTVRI
SSFYASVPMGPQDQPDFVNAVAGFETIFTPFELLTFCQQLEQQAKRARLRHWGERSLDVD
ILLYGNERISEPTLTIPHVGLHERNFVLIPLRELAPELMIVGKSIIDYPQSSDWAGLKLL
EHDASSHK
NT seq 567 nt NT seq  +upstreamnt  +downstreamnt
atgaacacgcgctttaatgatactgattttgatagcaaatctatcgccatttgctcttgg
gtcacttgttatgttggcttgggtagcaatctggtaaatgagcttggggcgcctgttgag
catttacagcacgcgtttgagatgatgcaagagcaagaaaagatacgcactgtgcgtatt
tcttcattttatgcctcggtaccgatgggaccgcaagatcagccagattttgtcaacgcc
gttgctggctttgaaactatatttacgccgtttgagctgctgacattttgccaacagttg
gagcagcaagcaaaacgcgcccgcctgcgtcattggggtgagcgtagtcttgatgtggat
atattgttatacggcaatgagcggatttctgagccaacattaacgataccccatgtgggt
ttgcatgagcgtaattttgttttgataccgttacgagagctcgcacctgagctaatgatt
gtaggaaagtcgataatcgactatccccaaagcagcgattgggcaggtttgaagctgtta
gaacatgatgcgtcaagtcataaataa

DBGET integrated database retrieval system