KEGG   Psychrobacter cryohalolentis: Pcryo_0198Help
Entry
Pcryo_0198        CDS       T00350                                 

Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pcryo_0198
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pcryo_0198
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pcryo_0198
Enzymes [BR:pcr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pcryo_0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
233837..235063
Genome map
AA seq 408 aa AA seqDB search
MTTQNTATGYGLHQSILPNDDGLYGEFGGKIGHPELAKAMAEIEVGFREIIKNDDFIAEM
KRLRETYVGRPSPIYHAQRLTEHCGGAQIYFKREDLNHTGAHKINHCLGEVLLAKKLGKT
KVIAETGAGQHGVALATAAALMGLECEIHMGVVDIKKEHPNVSRMKILGANIVPVSRGAG
TLKEAVDSAFETYLDELDSSMFAIGSALGPAPYPEMVSYFQSVVGHEARAQFLATTGKLP
NKVVACIGGGSNAIGMFSGFFDDKDVEKIGVEPAGEGLDTPNHAATMSLGVKGEIHGFKC
YVLLDEKGEPAPVHSIASGLDYPGVGPQHSHLRDLKLATYESATDAECLEAFMALSRLEG
IIPALESAHAIAYAMKIAKDMSADETILVNLSGRGDKDIDFILDKVDL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgacaacgcaaaataccgccactggctacggtttacatcaatcaattttgcccaatgac
gatggtctatatggtgagttcggtggcaaaatcggtcatcctgagcttgccaaagccatg
gcagaaatcgaagtgggctttcgtgaaatcattaaaaatgacgattttatcgctgagatg
aagcgcttgcgtgagacctatgttggtcgtccaagtcctatttatcatgcacagcgtttg
accgagcattgcggaggcgcgcagatttattttaagcgtgaagatttaaatcatacgggt
gcgcataagattaatcactgtttgggtgaagtattattagccaagaaattaggcaaaacc
aaagtgattgccgaaacgggcgcggggcaacatggcgtagcattggcaacggcagcggca
ttgatgggcttggaatgtgagattcacatgggtgtggtcgatattaaaaaagagcatcca
aacgtcagtcgtatgaagattttgggtgccaatatcgtgccagtctcgcgcggtgctggt
acgctaaaagaagcggttgatagtgcttttgagacttatttggatgagcttgatagcagt
atgttcgcgattggctcggcactgggacctgcgccctaccctgaaatggtcagctatttt
cagtcagtggttggtcatgaagcgcgggcgcagttcttagcgacgacgggtaagctacct
aataaagtggttgcttgtattggcggcggctctaatgctatcggtatgtttagcggcttt
tttgatgataaagatgtagaaaaaataggcgtggaacccgcaggcgaaggtctggatact
cctaatcatgcggcgacaatgtcgctcggcgtgaaaggtgagattcatggttttaaatgc
tatgtgctgctcgatgaaaaaggcgagccagctcccgtacattcgattgcctccggtctt
gattatcctggggttggaccacagcactcacatctgcgagatttaaaactggccacttat
gagtcggcgactgatgctgaatgtctagaagcgtttatggcattgtcgcgccttgagggt
attattcctgctttagagtcggcacatgccatcgcttatgcgatgaaaatcgccaaggat
atgtcagcggatgagacgattttggtcaatttgtcagggcgtggcgataaagacatcgat
tttattttggacaaggtggatttataa

DBGET integrated database retrieval system