KEGG   Psychrobacter cryohalolentis: Pcryo_0203Help
Entry
Pcryo_0203        CDS       T00350                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr00010  Glycolysis / Gluconeogenesis
pcr00620  Pyruvate metabolism
pcr00640  Propanoate metabolism
pcr00680  Methane metabolism
pcr01100  Metabolic pathways
pcr01110  Biosynthesis of secondary metabolites
pcr01120  Microbial metabolism in diverse environments
pcr01130  Biosynthesis of antibiotics
pcr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcryo_0203
   00620 Pyruvate metabolism
    Pcryo_0203
   00640 Propanoate metabolism
    Pcryo_0203
  Energy metabolism
   00680 Methane metabolism
    Pcryo_0203
Enzymes [BR:pcr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pcryo_0203
Lipid biosynthesis proteins [BR:pcr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pcryo_0203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABE73987
JGI: Pcryo0203
UniProt: Q1QEB6
Position
239497..241464
Genome map
AA seq 655 aa AA seqDB search
MTQKSFPIAPEFLAAANITAEQYAEQYKQSIASPEATDAFWAERAELIDWIKKPTKISDV
SYDLEDFRIKWFEDGELNISVNCLDRHVRNNPYKPAIIWEGDHPSLHKIISFKELHEAVC
RLGNAMRKLGVKKGDRVTLYMPMIPEAMVAMLACTRIGAVHSVVFGGFSAESLGNRIIDS
QSKLVITADEGIRGNKRTPLKANVDRALDMDGTDSVSNVIVVHRTGNSVPMSGRRDIWYH
SLVDGESQHCEPEVMNAEDPLFLLYTSGSTGKPKGVLHTTGGYITYALSTFRDVFDIKED
DVYWCTADVGWVTGHTYATYAPLANGTTTVMFEGVPEYPTWARIGHIIDKHQITVLYTAP
TAIRAMMKEGDTFVRESDRSSLRLLGTVGEPINPEAWDWYYHVVGGSKCPVVDTWWQTET
GGIMLAPIPGTVAMKPGAAMNPLYGIVPEVIDTDGVALEGAAEGNLVINSSWPGQMRTIY
QDHARFLTTYFTEYPGYYFTGDGVQRDEDGHYWITGRVDDVLNVSGHRLGTAEIESSIVA
HPATAEAAVVGMPHDIRGMGICAFVILKSSETATESLKSELNRHVRSEIGPIANLDAIYM
VNVLPKTRSGKIMRRILRSLAAGQYVGLGDLSTLADSSVINELVEVVKTERAKSH
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaaaatcatttcccattgcgcctgaattcctcgccgcagccaatattaccgcc
gaacagtatgctgaacaatataagcaatcaattgcgtcacctgaggcgacagatgccttt
tgggcggagcgtgccgagctgattgattggataaaaaagcccaccaaaatcagcgacgtc
agctacgacttagaagactttcgcattaaatggtttgaggatggcgagctgaatatttca
gtcaactgtctggatcgccacgtcagaaataatccctataagcctgccattatttgggaa
ggcgatcatccttccttgcataaaatcatatcatttaaagaactgcatgaagccgtttgt
cgcttaggtaatgccatgcgcaagcttggggtcaaaaagggcgaccgcgttaccttatat
atgccgatgataccggaagcgatggttgccatgctggcgtgtacgcgtattggcgccgtg
cattcggtggtctttggcggtttttccgctgagagcttgggtaatcgtatcattgatagt
cagtctaagctggtcattaccgctgatgaaggtattcgtggtaacaagcgtacgccactc
aaggctaatgtcgatcgcgcgctagatatggatggcactgacagtgtcagtaatgtcatc
gtcgtccatcgtacaggcaattcagtaccgatgagtggtcgccgtgatatctggtatcac
agcttggtcgatggtgagtcgcagcactgcgaacctgaagttatgaatgcagaagaccca
ctgtttttattatatacctctggttcaacaggcaagcccaaaggcgtgttgcacaccaca
ggcggttatatcacttatgcgctgtccacgtttcgtgatgtttttgatatcaaagaggat
gatgtgtattggtgtaccgcagacgtcggttgggtgacaggtcatacttatgccacttac
gcaccgcttgctaatggcaccacgaccgttatgtttgagggcgtgccagagtatccgaca
tgggcacgcattgggcatatcatcgataagcaccaaattactgtcttgtatactgcaccg
accgctatccgcgccatgatgaaagagggcgatacctttgtacgtgaatcggatcgctca
agtttgcgcttacttgggacggttggtgagccaattaatcctgaagcatgggactggtac
tatcatgtcgtcggtggcagcaagtgtccggttgtcgatacttggtggcagacagaaacg
ggcggtattatgctcgcgccaataccggggacggtcgcaatgaagccgggcgcggcgatg
aatcctctatatggtatcgtccctgaagtcattgatactgacggcgttgcgcttgaaggt
gctgctgagggtaatttggtaattaatagtagctggcccggtcagatgcgtaccatttat
caagaccacgcgcgctttttaacgacgtattttaccgaatatcccggctattattttacc
ggtgatggggtacagcgtgatgaagatggtcactattggattaccggtcgtgtcgacgat
gtgctcaatgtgtcaggacatagactgggcacagcagaaattgaaagctcgatcgttgca
cacccagcgacggcagaggcagctgtcgtaggaatgccacacgatatacgtggcatggga
atttgcgcctttgttatcttaaagtcgagtgagacggcaactgaatcactaaaatcggag
ttaaaccgccatgtgcgctctgagattggtccgattgccaatctagatgccatctatatg
gttaatgtactacctaaaacccgctctggtaaaatcatgcgccgtattttgcgtagtcta
gcggcaggacagtatgttggattgggtgatttatctaccctagctgacagctcagttatt
aacgagctggtcgaagtggttaaaaccgaacgggcaaaatcacattga

DBGET integrated database retrieval system