KEGG   Psychrobacter cryohalolentis: Pcryo_0203Help
Entry
Pcryo_0203        CDS       T00350                                 

Definition
acetyl-CoA synthetase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Pcryo_0203
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Pcryo_0203
   00620 Pyruvate metabolism
    Pcryo_0203
   00640 Propanoate metabolism
    Pcryo_0203
  Energy metabolism
   00680 Methane metabolism
    Pcryo_0203
Enzymes [BR:pcr01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Pcryo_0203
Lipid biosynthesis proteins [BR:pcr01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Pcryo_0203
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
239497..241464
Genome map
AA seq 655 aa AA seqDB search
MTQKSFPIAPEFLAAANITAEQYAEQYKQSIASPEATDAFWAERAELIDWIKKPTKISDV
SYDLEDFRIKWFEDGELNISVNCLDRHVRNNPYKPAIIWEGDHPSLHKIISFKELHEAVC
RLGNAMRKLGVKKGDRVTLYMPMIPEAMVAMLACTRIGAVHSVVFGGFSAESLGNRIIDS
QSKLVITADEGIRGNKRTPLKANVDRALDMDGTDSVSNVIVVHRTGNSVPMSGRRDIWYH
SLVDGESQHCEPEVMNAEDPLFLLYTSGSTGKPKGVLHTTGGYITYALSTFRDVFDIKED
DVYWCTADVGWVTGHTYATYAPLANGTTTVMFEGVPEYPTWARIGHIIDKHQITVLYTAP
TAIRAMMKEGDTFVRESDRSSLRLLGTVGEPINPEAWDWYYHVVGGSKCPVVDTWWQTET
GGIMLAPIPGTVAMKPGAAMNPLYGIVPEVIDTDGVALEGAAEGNLVINSSWPGQMRTIY
QDHARFLTTYFTEYPGYYFTGDGVQRDEDGHYWITGRVDDVLNVSGHRLGTAEIESSIVA
HPATAEAAVVGMPHDIRGMGICAFVILKSSETATESLKSELNRHVRSEIGPIANLDAIYM
VNVLPKTRSGKIMRRILRSLAAGQYVGLGDLSTLADSSVINELVEVVKTERAKSH
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgactcaaaaatcatttcccattgcgcctgaattcctcgccgcagccaatattaccgcc
gaacagtatgctgaacaatataagcaatcaattgcgtcacctgaggcgacagatgccttt
tgggcggagcgtgccgagctgattgattggataaaaaagcccaccaaaatcagcgacgtc
agctacgacttagaagactttcgcattaaatggtttgaggatggcgagctgaatatttca
gtcaactgtctggatcgccacgtcagaaataatccctataagcctgccattatttgggaa
ggcgatcatccttccttgcataaaatcatatcatttaaagaactgcatgaagccgtttgt
cgcttaggtaatgccatgcgcaagcttggggtcaaaaagggcgaccgcgttaccttatat
atgccgatgataccggaagcgatggttgccatgctggcgtgtacgcgtattggcgccgtg
cattcggtggtctttggcggtttttccgctgagagcttgggtaatcgtatcattgatagt
cagtctaagctggtcattaccgctgatgaaggtattcgtggtaacaagcgtacgccactc
aaggctaatgtcgatcgcgcgctagatatggatggcactgacagtgtcagtaatgtcatc
gtcgtccatcgtacaggcaattcagtaccgatgagtggtcgccgtgatatctggtatcac
agcttggtcgatggtgagtcgcagcactgcgaacctgaagttatgaatgcagaagaccca
ctgtttttattatatacctctggttcaacaggcaagcccaaaggcgtgttgcacaccaca
ggcggttatatcacttatgcgctgtccacgtttcgtgatgtttttgatatcaaagaggat
gatgtgtattggtgtaccgcagacgtcggttgggtgacaggtcatacttatgccacttac
gcaccgcttgctaatggcaccacgaccgttatgtttgagggcgtgccagagtatccgaca
tgggcacgcattgggcatatcatcgataagcaccaaattactgtcttgtatactgcaccg
accgctatccgcgccatgatgaaagagggcgatacctttgtacgtgaatcggatcgctca
agtttgcgcttacttgggacggttggtgagccaattaatcctgaagcatgggactggtac
tatcatgtcgtcggtggcagcaagtgtccggttgtcgatacttggtggcagacagaaacg
ggcggtattatgctcgcgccaataccggggacggtcgcaatgaagccgggcgcggcgatg
aatcctctatatggtatcgtccctgaagtcattgatactgacggcgttgcgcttgaaggt
gctgctgagggtaatttggtaattaatagtagctggcccggtcagatgcgtaccatttat
caagaccacgcgcgctttttaacgacgtattttaccgaatatcccggctattattttacc
ggtgatggggtacagcgtgatgaagatggtcactattggattaccggtcgtgtcgacgat
gtgctcaatgtgtcaggacatagactgggcacagcagaaattgaaagctcgatcgttgca
cacccagcgacggcagaggcagctgtcgtaggaatgccacacgatatacgtggcatggga
atttgcgcctttgttatcttaaagtcgagtgagacggcaactgaatcactaaaatcggag
ttaaaccgccatgtgcgctctgagattggtccgattgccaatctagatgccatctatatg
gttaatgtactacctaaaacccgctctggtaaaatcatgcgccgtattttgcgtagtcta
gcggcaggacagtatgttggattgggtgatttatctaccctagctgacagctcagttatt
aacgagctggtcgaagtggttaaaaccgaacgggcaaaatcacattga

DBGET integrated database retrieval system