KEGG   Psychrobacter cryohalolentis: Pcryo_0260Help
Entry
Pcryo_0260        CDS       T00350                                 

Definition
(GenBank) Phospholipase A1
  KO
K01058  phospholipase A1/A2 [EC:3.1.1.32 3.1.1.4]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr00564  Glycerophospholipid metabolism
pcr00565  Ether lipid metabolism
pcr00590  Arachidonic acid metabolism
pcr00592  alpha-Linolenic acid metabolism
pcr01100  Metabolic pathways
pcr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Pcryo_0260
   00565 Ether lipid metabolism
    Pcryo_0260
   00590 Arachidonic acid metabolism
    Pcryo_0260
   00591 Linoleic acid metabolism
    Pcryo_0260
   00592 alpha-Linolenic acid metabolism
    Pcryo_0260
Enzymes [BR:pcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Pcryo_0260
    3.1.1.32  phospholipase A1
     Pcryo_0260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PLA1 VasI
Motif
Other DBs
NCBI-ProteinID: ABE74044
JGI: Pcryo0260
UniProt: Q1QE59
Position
308802..310220
Genome map
AA seq 472 aa AA seqDB search
MFSHITSQRPSVNKLETPKKMMLRTTKCSLHIAVGIALTCFTVQAQAADTAQTKSLQPIN
TSIAVQNSNAVSEDFIAQQAALFFECTQVQTSSARLACFDKVAEQGKTPSYVTTKQPVDL
AKTVISTLSGNPQVILAEETSTITANGNVIAKKVSSNYPQDIETKLPAETESLDTVGLTQ
REAEVLESVGVTQADIEKYTPLSLAYDLDKNSERGTWTVRPYRPTYVMPLFYTFDPNLSP
STPTRPQPEKPFTSNDTRNTDLKFQLSLKTKVAEDLFNTNADLWFGYTQESHWQVYNEDN
SRPFRATDYQPEIFLTQPVTANLPFGGRLRMLGAGAIHHSNGQDDPLSRSWNRAYVMAGA
EWGKLSVIPRFWLRVNNENDSSEDNPDIEDFMGYGDIKFLYDLPNQQSLSGTLRYNPGTN
KGAAQIDYIYPLSKNVNGFVQLFQGYGESIVDYNHENTAIGFGIVLNDWKGL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgttttcccatattacttcgcagcgcccctctgtaaataaacttgaaacgccaaaaaaa
atgatgcttcgaacgactaaatgctctctacacatcgctgttggtatagcgctcacttgt
ttcacagtacaagctcaggctgctgatacagctcagactaagagcttacagcctataaat
accagtatcgctgtgcaaaatagcaatgcagtaagcgaagattttatcgctcagcaagct
gctctgttctttgaatgtactcaagtacagaccagttctgcccgtttggcatgctttgat
aaggttgcagaacaaggcaaaacgccaagttatgtcacaaccaaacagccagtagatttg
gcaaaaacggttataagtacgctgtcaggcaaccctcaagtgatactggctgaagaaacc
agtaccattactgccaatggcaatgtcattgctaaaaaggtttcgagcaattatcctcaa
gatattgaaacaaaactgcccgctgagactgaaagtttagatacggttggactgacgcaa
agagaagcagaggtattggaaagtgtcggcgtgactcaagcagatattgaaaaatatacg
ccgctaagcttagcatatgatcttgataaaaacagtgaacgcggtacatggacagtcaga
ccttaccgtccaacctatgttatgccactgttttatacctttgatcccaatttaagccca
agtacacccactcgacctcaaccagagaagccttttacgtctaacgacactcgtaatacg
gatctaaagtttcaactatcattaaagactaaagttgcagaagatttgtttaataccaat
gctgatttgtggtttggttatactcaagagtcgcattggcaagtttataatgaagacaat
tcacgaccatttcgtgcaaccgattatcagccagaaatatttttgacccagcctgtgaca
gcaaatctgccttttggtggacgactgcgcatgctcggagcaggtgctattcaccactca
aatggtcaagatgatccattatcgcgctcgtggaaccgtgcttatgtgatggcaggggca
gaatggggcaagttatctgtcataccgcgattctggttacgagtgaacaatgaaaatgat
agcagtgaagacaatccagatattgaagattttatgggttatggtgatatcaagttctta
tatgatttaccaaatcaacaaagcctaagcggtacgttgcgctacaatccaggcactaat
aaaggcgctgcgcaaatcgattatatttatccgttatctaaaaacgttaatggctttgta
cagctgttccaagggtatggcgaatctattgttgattataaccatgaaaatacggctatc
ggctttggtatcgtactcaatgattggaaagggctgtaa

DBGET integrated database retrieval system