KEGG   Psychrobacter cryohalolentis: Pcryo_0260Help
Entry
Pcryo_0260        CDS       T00350                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Pcryo_0260
   00565 Ether lipid metabolism
    Pcryo_0260
   00590 Arachidonic acid metabolism
    Pcryo_0260
   00591 Linoleic acid metabolism
    Pcryo_0260
   00592 alpha-Linolenic acid metabolism
    Pcryo_0260
Enzymes [BR:pcr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Pcryo_0260
    3.1.1.32  phospholipase A1
     Pcryo_0260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
308802..310220
Genome map
AA seq 472 aa AA seqDB search
MFSHITSQRPSVNKLETPKKMMLRTTKCSLHIAVGIALTCFTVQAQAADTAQTKSLQPIN
TSIAVQNSNAVSEDFIAQQAALFFECTQVQTSSARLACFDKVAEQGKTPSYVTTKQPVDL
AKTVISTLSGNPQVILAEETSTITANGNVIAKKVSSNYPQDIETKLPAETESLDTVGLTQ
REAEVLESVGVTQADIEKYTPLSLAYDLDKNSERGTWTVRPYRPTYVMPLFYTFDPNLSP
STPTRPQPEKPFTSNDTRNTDLKFQLSLKTKVAEDLFNTNADLWFGYTQESHWQVYNEDN
SRPFRATDYQPEIFLTQPVTANLPFGGRLRMLGAGAIHHSNGQDDPLSRSWNRAYVMAGA
EWGKLSVIPRFWLRVNNENDSSEDNPDIEDFMGYGDIKFLYDLPNQQSLSGTLRYNPGTN
KGAAQIDYIYPLSKNVNGFVQLFQGYGESIVDYNHENTAIGFGIVLNDWKGL
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgttttcccatattacttcgcagcgcccctctgtaaataaacttgaaacgccaaaaaaa
atgatgcttcgaacgactaaatgctctctacacatcgctgttggtatagcgctcacttgt
ttcacagtacaagctcaggctgctgatacagctcagactaagagcttacagcctataaat
accagtatcgctgtgcaaaatagcaatgcagtaagcgaagattttatcgctcagcaagct
gctctgttctttgaatgtactcaagtacagaccagttctgcccgtttggcatgctttgat
aaggttgcagaacaaggcaaaacgccaagttatgtcacaaccaaacagccagtagatttg
gcaaaaacggttataagtacgctgtcaggcaaccctcaagtgatactggctgaagaaacc
agtaccattactgccaatggcaatgtcattgctaaaaaggtttcgagcaattatcctcaa
gatattgaaacaaaactgcccgctgagactgaaagtttagatacggttggactgacgcaa
agagaagcagaggtattggaaagtgtcggcgtgactcaagcagatattgaaaaatatacg
ccgctaagcttagcatatgatcttgataaaaacagtgaacgcggtacatggacagtcaga
ccttaccgtccaacctatgttatgccactgttttatacctttgatcccaatttaagccca
agtacacccactcgacctcaaccagagaagccttttacgtctaacgacactcgtaatacg
gatctaaagtttcaactatcattaaagactaaagttgcagaagatttgtttaataccaat
gctgatttgtggtttggttatactcaagagtcgcattggcaagtttataatgaagacaat
tcacgaccatttcgtgcaaccgattatcagccagaaatatttttgacccagcctgtgaca
gcaaatctgccttttggtggacgactgcgcatgctcggagcaggtgctattcaccactca
aatggtcaagatgatccattatcgcgctcgtggaaccgtgcttatgtgatggcaggggca
gaatggggcaagttatctgtcataccgcgattctggttacgagtgaacaatgaaaatgat
agcagtgaagacaatccagatattgaagattttatgggttatggtgatatcaagttctta
tatgatttaccaaatcaacaaagcctaagcggtacgttgcgctacaatccaggcactaat
aaaggcgctgcgcaaatcgattatatttatccgttatctaaaaacgttaatggctttgta
cagctgttccaagggtatggcgaatctattgttgattataaccatgaaaatacggctatc
ggctttggtatcgtactcaatgattggaaagggctgtaa

DBGET integrated database retrieval system