KEGG   Psychrobacter cryohalolentis: Pcryo_0468Help
Entry
Pcryo_0468        CDS       T00350                                 

Definition
(GenBank) tryptophan synthase, alpha chain
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Pcryo_0468
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Pcryo_0468
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Pcryo_0468
Enzymes [BR:pcr01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Pcryo_0468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
574322..575140
Genome map
AA seq 272 aa AA seqDB search
MTRIESTFETLKAQNKKALIPYVMAGDPNPSNFVGLLHDLVKHGADMIEVGLPFSDPMAD
GPTVALAGERALAAGTSTRDALKMVKEFRQQDTQTPIILMGYLNPVEIIGYDNFVSLCEQ
SGVDGILMVDLPPAEAGSFTQHLTEHAMNEIFLLSPTTLAERRQQVLTHCGGYIYYVSLK
GVTGSATLDTDDVAKQVQAIKAETDLPVCVGFGIRDATSAKAIGAHADGIIVGSALVQNF
ADIDANDITAVANAQQKIMAKMDELRGALDSL
NT seq 819 nt NT seq  +upstreamnt  +downstreamnt
atgacccgaattgaaagcacctttgaaaccctaaaagcacaaaataaaaaagcactcatc
ccttatgtgatggcaggcgatcccaatccaagcaactttgttggcttgctgcatgattta
gtcaagcatggcgcagatatgattgaagtgggcttaccattttctgacccaatggcagat
ggtcctacagtagcattggcaggcgagcgtgcattagcagcgggtacgagcactcgtgat
gcactaaagatggtcaaagagttccgtcagcaagatacgcagacgccaattatcctgatg
ggttaccttaatccagtagagattatcggttatgataactttgtctctttatgtgagcag
tcaggcgtcgatggtattttgatggttgatttgccgccagcagaagcgggtagctttacc
cagcatttgactgagcacgcgatgaatgagattttcttattatcaccaactacgctggct
gaacgtcgtcagcaagtattgacccattgcggtggttatatctactacgtgtctttaaaa
ggcgtgacgggttcagcaacgctagatactgacgatgttgcaaagcaagtacaggccatt
aaagcagagacagatttgccagtatgtgtgggctttggtattcgtgatgcaacttctgcc
aaagcaattggtgctcatgcggatggtattatcgtcggtagtgcattggtacagaacttt
gctgatatcgatgccaatgatatcactgcagtcgctaatgctcagcaaaaaattatggca
aaaatggatgagttacgcggcgcactcgatagtttataa

DBGET integrated database retrieval system