KEGG   Psychrobacter cryohalolentis: Pcryo_0475Help
Entry
Pcryo_0475        CDS       T00350                                 

Gene name
gatB
Definition
aspartyl/glutamyl-tRNA amidotransferase subunit B
Orthology
K02434  
aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Aminoacyl-tRNA biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Genetic Information Processing
  Translation
   00970 Aminoacyl-tRNA biosynthesis
    Pcryo_0475 (gatB)
Enzymes [BR:pcr01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Pcryo_0475 (gatB)
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Pcryo_0475 (gatB)
Mitochondrial biogenesis [BR:pcr03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Pcryo_0475 (gatB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(582842..584371)
Genome map
AA seq 509 aa AA seqDB search
MNTATTTDNNAVRKHDVRKELFVDGYEVVIGIEIHCQLNTESKIFSSAPTDFGHEPNSQA
SIVDLGLPGVLPVLNAGVVDRALKFGIGVNAELGLFNTFDRKNYFYPDLPKGYQITQMAN
PIVGEGYIDVVVNEGEKNEYPKRMGITRAHLEEDAGKSVHDAVDGMTGVDLNRAGTPLIE
IVSEPDMRSAHEALAYIKAIHQLVTWLGISDAIMAEGSFRCDCNVSIRKPGAELGTRTEL
KNLNSFRFIERAINREIERQIDILEDGGKVVQATMLYDPERDETRVMRTKEDANDYRYFP
DPDLLPVRIEQHTVDSIRAAMPELPVARRARFEEALGLSEYDARILTGSRQIADYFENVV
AEVGQADAKMAANWVMGDLLGALNKDDKEITDSPISAKQLAGMLSRIKDDTLSGKLAKKV
FSALYEREGGDADDAADKIIEEKGLKQETDTGAIKAIVEDVIAKNAAMVEEYRGGKEKAF
NGLVGQVMKASRGSANPQQVNQILKELLG
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgaatacagcaactactactgataacaacgccgttcgcaaacacgatgttcgtaaagag
ctattcgtcgatggttatgaagtggtcatcggtatcgagattcactgtcagctgaacaca
gaaagtaagatattctcgagcgcgccgactgactttggtcacgagccaaacagccaagcc
agtattgtagatttaggcttaccgggtgtcttgccagtgctaaatgctggtgtggttgat
cgtgcgctaaaattcggtatcggcgtcaacgctgagctgggtctatttaatacttttgac
cgcaaaaactacttttaccctgatttaccgaaaggctatcaaatcacccagatggccaac
cctatcgttggcgaaggctatatagatgtcgtggtcaatgaaggtgaaaagaacgaatat
ccaaaacgtatgggtatcacccgcgcgcatctagaagaagatgctggtaaatcagtacac
gatgccgtcgatggtatgacgggcgtggatctaaaccgcgctggtacgcctttgattgaa
atcgtctctgaacctgatatgcgctcagctcacgaagcactggcctatatcaaagccatt
catcagctggtcacgtggctaggtatctcagatgctatcatggcagaaggctcattccgc
tgtgattgtaacgtctctatccgtaaacctggtgctgagttggggacgcgtactgagctt
aagaacttaaactcgttccgcttcatcgagcgtgccatcaatcgcgaaatcgagcgtcag
attgacattttagaagacggcggtaaagttgtacaagcaacgatgctttatgacccagag
cgcgacgaaactcgtgttatgcgtaccaaagaagacgccaatgattatcgctactttcct
gatcctgacttgctacctgtgcgtatcgagcagcatacggttgatagcattcgtgcagcg
atgcctgagctaccggttgcccgccgtgcgcgttttgaagaagcgcttggtctttcagaa
tatgacgctcgtattttgactggtagccgtcaaattgctgattactttgaaaatgtggtc
gcagaagttgggcaagcagatgccaaaatggcagctaactgggtaatgggcgacctactc
ggtgcgttgaataaagatgataaggaaattactgactcccctatcagcgccaagcaattg
gctggtatgctatcacgcatcaaagacgataccctatctggcaaactggctaagaaggtc
tttagtgccttatatgagcgcgaaggtggcgatgctgatgatgcagcagataaaatcatc
gaggaaaaaggtcttaagcaagaaaccgatacgggcgctatcaaagccatcgttgaagac
gtcattgctaaaaatgcagcgatggttgaagagtatcgcggcggtaaagaaaaagccttc
aatggtttagttggtcaagtaatgaaagccagtcgcggtagtgccaatccacagcaagtc
aaccaaattctgaaagagttactgggttaa

DBGET integrated database retrieval system