KEGG   Psychrobacter cryohalolentis: Pcryo_0531Help
Entry
Pcryo_0531        CDS       T00350                                 

Gene name
pyrB
Definition
aspartate carbamoyltransferase catalytic subunit
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Pcryo_0531 (pyrB)
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Pcryo_0531 (pyrB)
Enzymes [BR:pcr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.3  Carboxy- and carbamoyltransferases
    2.1.3.2  aspartate carbamoyltransferase
     Pcryo_0531 (pyrB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
627728..628801
Genome map
AA seq 357 aa AA seqDB search
MSNSIDSQSLPTVSPTDYARFDPDTIHEKLDASLSRPQLNTDGSIRHFLGIEGLNKAQLQ
AIIAKAESFFDDKGQLINRPELEGYTVMNLFFEPSTRTRTTFEVAEKRLGANVLNIDIER
SSTKKGESLRDTLWNLQAMTADIFVVRHSASGAAHFMATEVTPDIAIINGGDGWHAHPTQ
GMLDMLTIHREAPRPFEELSVAIVGDIKHSRVARSDISALQTLGVKDIRVCAPRTLLPKG
IERFGVQVYENMNECVTDCDVIMGLRIQNERIGSPLLASSSEYYKHYGITPERVALAKPD
ALVMHPGPMNRGVEIASSVADGAQSVILKQVNNGIAIRMAVLSLAMEGQRAHQAAGH
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaattctatcgatagccaatcactacctaccgtctcgccgacagactacgcaaga
tttgatcctgatacgattcatgaaaaacttgatgcgtcattgagtcgtccgcagctcaat
actgatggtagtattcgtcattttttaggtatcgaaggtcttaataaagcccagctgcag
gcgattatcgctaaagctgagtcattttttgatgataagggacagctgattaaccgtcct
gagcttgaaggctatacggtgatgaatctgttttttgagccatcgacgcgcacacgtacc
acgtttgaagtagcagaaaaacgtttaggcgctaatgtattaaatatcgatatcgaacgc
tctagcaccaaaaaaggcgaaagcttacgcgatacgttatggaatctgcaagcgatgacg
gcagatatctttgtggtacgtcattcagcatcaggtgcggcacattttatggcgactgaa
gtgacgccagatattgccattatcaatggtggtgatggttggcatgcgcatccaacgcaa
ggcatgcttgatatgctgactattcaccgtgaggcgccgcgtccttttgaagagctgtcg
gttgcaatcgttggcgatatcaaacactcgcgagtagcacgctctgacatcagtgcgcta
caaacattgggtgtaaaagacattcgcgtctgcgcacctcgtacgttattaccaaaaggg
attgagcgttttggtgtgcaagtatatgagaatatgaatgaatgcgtgacggactgtgat
gtcattatgggcttgagaattcaaaatgagcgtattggctcaccgctcctcgcctcatcg
agtgaatactataagcactatggtattactcctgagcgcgtggcactggcgaagcctgat
gctctagttatgcacccaggaccgatgaaccgcggtgttgagattgcctcaagcgttgcc
gatggtgcgcaatctgtgattttaaaacaggttaataacggcattgctattcgtatggcg
gtactgtcactggcgatggaaggtcagcgcgcgcatcaagcggctggtcattaa

DBGET integrated database retrieval system