KEGG   Psychrobacter cryohalolentis: Pcryo_0549Help
Entry
Pcryo_0549        CDS       T00350                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr00300  Lysine biosynthesis
pcr01100  Metabolic pathways
pcr01120  Microbial metabolism in diverse environments
pcr01230  Biosynthesis of amino acids
Module
pcr_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Pcryo_0549
Enzymes [BR:pcr01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Pcryo_0549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ABE74332
JGI: Pcryo0549
UniProt: Q1QDC1
Position
complement(646462..647685)
Genome map
AA seq 407 aa AA seqDB search
MSDFDKNRNTQSQTQATHQQATLDLSIALLERPSVTPDDDGCQDILSERLTQAGFDCEFM
YYGDRQAKGEHAEVKNLWARRGNTNPVICFAGHTDVVPTGDEKNWTYPPFTPTIADGYLW
ARGAADMKTGIAAFTVAAERFVANHPEHNGSIAFLITSDEEGPSINGTVKVVETLEARNE
KITYCLVGEPSSTDTLGDIIKNGRRGSLGAVLTVTGKQGHVAYPHLASNPIHAAMSALAE
LTNATWDNGNDYFPATSLQISNINSGTGATNVIPETLEAVFNFRFSTETSEDELKAKTHA
IFDRYFADSKAAYDIHWKLSGQPFLTPEGKLVSACQQAIKSVTGTDTTLSTSGGTSDGRF
IAPTGAQVVELGVRNATIHQVDEKVEVDDLGKLAQIYEGILENLLLD
NT seq 1224 nt NT seq  +upstreamnt  +downstreamnt
atgtcagattttgataaaaaccgaaatactcagtctcagacgcaagcaactcatcaacaa
gcaaccttggacttaagcatcgccctacttgaacgtccatcagtgacgccagatgatgac
ggctgccaagacatattgtctgagcggctaacgcaagcaggcttcgactgcgagtttatg
tattacggtgatagacaagcaaaaggcgaacacgctgaggttaaaaacttatgggcgcgc
cgcggtaataccaatccagtcatttgctttgcaggtcatactgacgtcgtcccaacaggc
gatgaaaaaaattggacctatccgccctttaccccaaccattgcagatggctatttatgg
gcgcgtggtgccgctgatatgaaaactggtattgccgcttttaccgtcgctgctgagcgt
ttcgttgccaatcatcctgagcacaatggctctattgcttttttaatcacctcagatgaa
gaaggcccttctattaacggcacagtcaaggtagtagaaacgctagaagcgcgcaatgag
aaaattacgtactgcttggttggtgaaccatcaagcacggatacattaggcgatatcatc
aagaatggtcgtcgtggctcactcggcgcagtacttaccgtcactggtaaacaaggtcat
gttgcctacccgcaccttgcctcaaatcccattcatgcggctatgtcggcactcgcagaa
ctgaccaatgctacttgggataatggcaatgattacttccctgcgacttcactacaaata
tctaatatcaatagtggaacgggcgcaaccaacgtcattcctgaaaccttagaagctgta
tttaacttccgcttttcaacagaaacgtctgaagatgaactaaaagcaaaaacccacgct
atctttgatagatatttcgctgatagcaaagcagcttatgatattcattggaaattatct
ggtcagccttttttgacgcctgaaggtaaattggtctcagcatgccagcaagcgattaaa
tctgtgactggaaccgatacgacattatcaacttctggcggcacatcagatggacgcttt
attgcaccaacgggtgcgcaagtggtcgaacttggtgtgcgtaatgccactattcatcaa
gttgatgaaaaagttgaagtagacgacttaggaaaattggcgcagatttatgaagggatt
ttagagaatttactattagattaa

DBGET integrated database retrieval system