KEGG   Psychrobacter cryohalolentis: Pcryo_0694Help
Entry
Pcryo_0694        CDS       T00350                                 

Definition
(GenBank) Glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
pcr  Psychrobacter cryohalolentis
Pathway
pcr00480  Glutathione metabolism
pcr00590  Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:pcr00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Pcryo_0694
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Pcryo_0694
Enzymes [BR:pcr01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Pcryo_0694
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ABE74477
JGI: Pcryo0694
UniProt: Q1QCX6
Position
824511..824996
Genome map
AA seq 161 aa AA seqDB search
MTTIYDFNAERIDGTTKSFSDYKDQVLLIVNTASKCGFTPQFEGLEALFQQYKDQGLMVI
GFPCNQFGNQDPANNDEIGEFCQKNYGVSFPMMAKVDVNGGDAHPVFEWLKNQKGGLLTD
GIKWNFTKFLIDSKGQVIARYAPTTKPEALKADIEQALAAK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgactactatttatgattttaatgctgagcgtatcgatggaacgacaaaaagtttctct
gactataaagatcaagtgttgctaattgttaataccgcaagcaagtgtggctttacgccg
cagtttgagggcttagaagcactgtttcagcaatataaagaccaaggtttaatggttatc
ggttttccctgtaatcaattcggcaaccaagatcctgctaataatgatgaaattggtgaa
ttttgccaaaagaactatggtgtgagctttccaatgatggcaaaagtcgacgtcaatggt
ggtgatgctcatcctgtgtttgaatggctaaaaaatcaaaaaggcgggcttctcacagat
ggtatcaaatggaatttcaccaagtttttaattgatagtaaagggcaggtaattgctcgt
tatgcaccaacgaccaaacctgaagcgctcaaggctgatatagaacaagcgctggctgca
aagtaa

DBGET integrated database retrieval system